Copied!

Search

Please enter your request:
EnzymeDetector confidence threshold: Leave blank to show all results.
Does not work when no organism is selected!


Your translated search: L-valine = 207 reactions were found.
State Icon Reaction EC-Number Conf. maximal confidence score from EnzymeDetector PW
H+ + L-valine <=> CO2 + Isobutylamine 4.1.1.14 valine decarboxylase
4.1.1.57 methionine decarboxylase


L-valine + H2O + NADP+ <=> 2-oxoisovalerate + NH3 + NADPH + H+ 1.4.1.23 valine dehydrogenase (NAD+)
1.4.1.3 glutamate dehydrogenase [NAD(P)+]
1.4.1.4 glutamate dehydrogenase (NADP+)
1.4.1.8 valine dehydrogenase (NADP+)




L-2-aminoadipate + L-cysteine + L-valine + ATP + H2O <=> H+ + N-[(5S)-5-amino-5-carboxypentanoyl]-L-cysteinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

MK
(S)-3-methyl-2-oxopentanoate + L-valine <=> L-isoleucine + 2-oxoisovalerate 2.6.1.32 valine---3-methyl-2-oxovalerate transaminase
2.6.1.42 branched-chain-amino-acid transaminase


pyruvate + L-valine <=> L-alanine + 2-oxoisovalerate 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.66 valine---pyruvate transaminase




BMK
L-valine + H2O + NAD+ <=> 2-oxoisovalerate + NH3 + NADH + H+ 1.4.1.1 alanine dehydrogenase
1.4.1.2 glutamate dehydrogenase
1.4.1.20 phenylalanine dehydrogenase
1.4.1.23 valine dehydrogenase (NAD+)
1.4.1.5 L-amino-acid dehydrogenase
1.4.1.8 valine dehydrogenase (NADP+)
1.4.1.9 leucine dehydrogenase







K
3-({[(2R,3R)-3-carbamoyloxiran-2-yl]carbonyl}amino)-L-alanine + L-valine + ATP <=> 3-({[(2R,3R)-3-carbamoyloxiran-2-yl]carbonyl}amino)-L-alanyl-L-valine + ADP + phosphate + H+ 6.3.2.47 dapdiamide synthase

M
N3-fumarylcarboxyamido-L-2,3-diaminopropionic_acid + L-valine + ATP <=> 3-{[(2E)-4-amino-4-oxobut-2-enoyl]amino}-L-alanyl-L-valine + ADP + phosphate + H+ 6.3.2.47 dapdiamide synthase

MK
L-valine + 2-oxoglutarate <=> L-glutamate + 2-oxoisovalerate 2.6.1.39 2-aminoadipate transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.6 leucine transaminase
2.6.1.66 valine---pyruvate transaminase




BMK
ATP + L-valine + H2O <=> ADP + phosphate + L-valine + H+ 7.4.2.2 ABC-type nonpolar-amino-acid transporter

B
jasmonic_acid + L-valine + ATP <=> H+ + jasmonoyl-L-valine + AMP + diphosphate 6.3
6.3.2.52 jasmonoyl---L-amino acid synthetase
6.3.2.z



M
L-valine + 2 flavin_hydroquinone + 2 O2 <=> (E/Z)-isobutyraldoxime + 2 [oxidized_NADPH-hemoprotein_reductase] + CO2 + 3 H2O 1.14.14.38 valine N-monooxygenase

K
L-valine + flavin_hydroquinone + O2 <=> N-hydroxy-L-valine + [oxidized_NADPH-hemoprotein_reductase] + H2O 1.14.14.38 valine N-monooxygenase
1.14.14.39 isoleucine N-monooxygenase


K
ATP + L-valine + tRNAMet <=> AMP + diphosphate + L-valyl-tRNAVal 6.1.1.9 valine---tRNA ligase

BK
L-Val-4-nitroanilide + H2O <=> L-valine + 4-nitroaniline 3.3.2.6 leukotriene-A4 hydrolase
3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.11.24 aminopeptidase S
3.4.11.5 prolyl aminopeptidase
3.4.11.6 aminopeptidase B
3.4.11.B9











N-acetyl-L-valine + H2O <=> L-valine + acetate 3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase
3.5.1.87 N-carbamoyl-L-amino-acid hydrolase


L-valine + H2O + O2 <=> 2-oxoisovalerate + NH3 + H2O2 1.4.3.2 L-amino-acid oxidase

L-valine + 4-methylsulfanyl-2-oxobutanoate <=> 2-oxoisovalerate + L-methionine 2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.88 methionine transaminase



L-leucine + 2-oxoisovalerate <=> 4-methyl-2-oxopentanoate + L-valine 2.6.1.42 branched-chain-amino-acid transaminase

Ala-Val + H2O <=> L-alanine + L-valine 3.4.11.14 cytosol alanyl aminopeptidase

Val-Pro + H2O <=> L-valine + L-proline 3.4.11.9 Xaa-Pro aminopeptidase
3.4.13.9 Xaa-Pro dipeptidase


carbobenzoxy-Gly-Gly-Val + H2O <=> benzyloxycarbonyl-Gly-Gly + L-valine 3.4.17.1 carboxypeptidase A

ATP + L-glutamate + L-valine <=> ADP + phosphate + 5-L-glutamyl-L-valine 6.3.2.2 glutamate---cysteine ligase

3''-L-valyl-gemcitabine + H2O <=> L-valine + gemcitabine 3.1.1.1 carboxylesterase

5''-L-valyl-gemcitabine + H2O <=> L-valine + gemcitabine 3.1.1.1 carboxylesterase

valacyclovir + H2O <=> L-valine + acyclovir 3.1.1.1 carboxylesterase
3.1.1.43 alpha-amino-acid esterase


valganciclovir + H2O <=> L-valine + ganciclovir 3.1.1.43 alpha-amino-acid esterase

L-valine + O2 + reduced_[NADPH-hemoprotein_reductase] <=> (E)-2-methylpropanal-oxime + oxidized_[NADPH-hemoprotein_reductase] + CO2 + H2O 1.14.14.38 valine N-monooxygenase

ATP + L-Arg-L-2-amino-5-phosphono-3-cis-pentenoate + L-valine <=> ADP + phosphate + Rhizocticin_B + H+ 6.3.2

M
ATP + L-arginyl-4-hydroxy-5-phosphonopentanoate + L-valine <=> ADP + phosphate + L-valyl-L-arginyl-4-hydroxy-5-phosphonopentanoate + H+ 6.3.2

M
S-adenosyl-L-methionine + R-2-hydroxy-3-methylpentanoyl-[acp] + ATP + L-valine <=> R-2-hydroxy-3-methylpentanoyl-methylvalyl-[acp] + AMP + diphosphate + H+ + S-adenosyl-L-homocysteine 6.3.2

M
S-adenosyl-L-methionine + R-2-hydroxy-3-methylpentanoate-methylvaline-phenylalanine-methylphenylalanine-proline-allo-isoleucyl-[acp] + ATP + L-valine <=> R-Hmp-MeVal-Phe-MePhe-Pro-alle-MeVal-[acp] + AMP + diphosphate + H+ + S-adenosyl-L-homocysteine 6.3.2

M
S-adenosyl-L-methionine + R-Hmp-MeVal-Phe-MePhe-Pro-alle-MeVal-Leu-[acp] + ATP + L-valine + NADPH + H+ + O2 <=> R-Hmp-MeVal-Phe-MePhe-Pro-alle-MeVal-Leu-MeVal-[acp] + AMP + diphosphate + H+ + S-adenosyl-L-homocysteine + NADP+ + H2O 6.3.2

M
L-valine + L-tryptophan + L-methionine + NADPH + H+ <=> N-methyl-L-valyl-L-tryptophanol + L-homocysteine + H2O + NADP+ 2.3.1

M
S-adenosyl-L-methionine + 3-hydroxy-4-methyl-anthranilyl-L-threonyl-D-valyl-[AcmD_acyl-carrier_protein] + L-valine + L-proline + glycine + ATP <=> 3-hydroxy-4-methyl-anthranilate_pentapeptide_lactone + S-adenosyl-L-homocysteine + holo-[AcmD_acyl-carrier_protein] + ADP + phosphate + H+ 6.3.1

M
3-hydroxy-4-methyl-anthranilyl-[AcmD_acyl-carrier_protein] + L-threonine + L-valine + ATP <=> 3-hydroxy-4-methyl-anthranilyl-L-threonyl-D-valyl-[AcmD_acyl-carrier_protein] + ADP + phosphate + H+ 6.3.1

M
S-adenosyl-L-methionine + quinoxaline-2-carboxyl-D-seryl-L-alanyl-[non-ribosomal_peptide_synthase] + L-cysteine + L-valine + ATP <=> triostin_A_dithiol + non-ribosomal_peptide_synthase + AMP + diphosphate + H+ + S-adenosyl-L-homocysteine 6.3.2

M
L-valine + O2 + reduced_[NADPH-hemoprotein_reductase] <=> N-hydroxy-L-valine + oxidized_[NADPH-hemoprotein_reductase] + H2O + H+ not assigned

M
indole-3-acetic_acid + L-valine + ATP <=> H+ + (indol-3-yl)acetyl-L-valine + AMP + diphosphate 6.3

M
D-phenylalanyl-[gramicidin-S_synthetase] + L-proline + L-valine + L-ornithine + L-leucine + ATP <=> D-phenylalanyl-L-prolyl-L-valyl-L-ornithyl-L-leucyl-[NRPS-pcp] + AMP + diphosphate + H+ not assigned

M
Na+ + L-valine <=> Na+ + L-valine not assigned

L-valine + H+ <=> L-valine + H+ not assigned

L-valine <=> L-valine not assigned

tRNAMet + L-valine + ATP <=> L-valyl-[tRNAVal] + diphosphate + AMP 6.1.1.9 valine---tRNA ligase

M
N-carbamoyl-L-valine + H2O <=> L-valine + CO2 + NH3 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

Val-amide + H2O <=> L-valine + NH3 3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.17 tryptophanyl aminopeptidase


N-formyl-L-valine + H2O <=> L-valine + CO2 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

Arg-Val + H2O <=> L-arginine + L-valine 3.4.11.1 leucyl aminopeptidase
3.4.11.15 aminopeptidase Y


valine_[3-(hydroxymethyl)phenyl]guanidine + H2O <=> L-valine + [3-(hydroxymethyl)phenyl]guanidine 3.1.1.43 alpha-amino-acid esterase

valine_[3-(aminomethyl)phenyl]guanidine + H2O <=> L-valine + [3-(aminomethyl)phenyl]guanidine 3.1.1.43 alpha-amino-acid esterase

Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val + H2O <=> Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu + L-valine 3.4.17.B4
3.4.17.B5


L-tryptophan + 2-oxoisovalerate <=> 3-Indole-2-oxopropanoate + L-valine 2.6.1.28 tryptophan---phenylpyruvate transaminase
2.6.1.99 L-tryptophan---pyruvate aminotransferase


D-glutamine + L-valine <=> D-Glu-Val + NH3 2.3.2.2 gamma-glutamyltransferase

N-benzyloxycarbonyl-Ala-Val + H2O <=> Benzyloxycarbonyl-Ala + L-valine 3.4.17.B4
3.4.17.B5


5''-O-L-valyl-2''-deoxy-5-fluorouridine + H2O <=> L-valine + 2''-deoxy-5-fluorouridine 3.1.1.43 alpha-amino-acid esterase

VVYPWTQRF + H2O <=> L-valine + VYPWTQRF 3.4.11.2 membrane alanyl aminopeptidase

2-chloroadenosine_5''-triphosphate + L-valine + tRNAMet <=> 2-chloroadenosine_5''-monophosphate + diphosphate + L-valyl-tRNAVal 6.1.1.9 valine---tRNA ligase

formycin_5''-triphosphate + L-valine + tRNAMet <=> formycin_5''-monophosphate + diphosphate + L-valyl-tRNAVal 6.1.1.9 valine---tRNA ligase

L-valine_2-naphthylamide + H2O <=> L-valine + 2-Naphthylamine 3.3.2.6 leukotriene-A4 hydrolase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.11.6 aminopeptidase B
3.5.1.13 aryl-acylamidase






valine_4-nitrobenzyl_ester + H2O <=> L-valine + 4-nitrobenzyl_alcohol 3.1.1.43 alpha-amino-acid esterase

tubercidin_5''-triphosphate + L-valine + tRNAMet <=> tubercidin_5''-monophosphate + diphosphate + L-valyl-tRNAVal 6.1.1.9 valine---tRNA ligase

jasmonoyl-L-valine + H2O <=> jasmonic_acid + L-valine 3.5.1.127 jasmonoyl-L-amino acid hydrolase

L-leucine + 2-oxobutyrate <=> 4-methyl-2-oxopentanoate + L-valine 2.6.1.42 branched-chain-amino-acid transaminase

L-valine + 2-oxoisovalerate <=> 2-oxoisovalerate + L-leucine 2.6.1.42 branched-chain-amino-acid transaminase

L-valine + 2-oxoisovalerate <=> 2-oxoisovalerate + L-valine 2.6.1.42 branched-chain-amino-acid transaminase

Diprotin_B + H2O <=> L-valine + Pro-Leu 3.4.11.9 Xaa-Pro aminopeptidase

5-L-glutamyl-L-valine <=> 5-oxoproline + L-valine 4.3.2.9 gamma-glutamylcyclotransferase

L-Val-L-Pro-L-Pro + H2O <=> L-valine + L-Pro-L-Pro 3.4.11.9 Xaa-Pro aminopeptidase

L-valine <=> D-valine 5.1.1.1 alanine racemase
5.1.1.10 amino-acid racemase
5.1.1.21 isoleucine 2-epimerase



furylacryloyl-Phe-Val + H2O <=> 3-(2-furyl)acryloyl-L-Phe + L-valine 3.4.16.5 carboxypeptidase C
3.4.17.1 carboxypeptidase A


pyroglutamic_acid-Val + H2O <=> 5-oxoproline + L-valine 3.4.19.3 pyroglutamyl-peptidase I

VYPWTQRF + H2O <=> L-valine + hemorphin-7_peptide 3.4.11.2 membrane alanyl aminopeptidase

L-isoleucine + 2-oxoisovalerate <=> 4-methyl-2-oxopentanoate + L-valine 2.6.1.42 branched-chain-amino-acid transaminase

acetyl-CoA + L-valine <=> CoA + N-acetyl-L-valine 2.3.1.66 leucine N-acetyltransferase

4-carbamimidamidobenzyl_L-valinate + H2O <=> L-valine + 1-[4-(hydroxymethyl)phenyl]guanidine 3.1.1.43 alpha-amino-acid esterase

L-histidine + 2-oxoisovalerate <=> 3-(1H-imidazol-4-yl)-2-oxopropanoate + L-valine 2.6.1.38 histidine transaminase

His-Pro-Val + H2O <=> His-Pro + L-valine 3.4.14.2 dipeptidyl-peptidase II

Val-Leu + H2O <=> L-valine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.23 PepB aminopeptidase


Nalpha-carbobenzoxy-Val + H2O <=> benzyl_alcohol + CO2 + L-valine 3.5.1.64 Nalpha-benzyloxycarbonylleucine hydrolase

Nalpha-carbobenzoxy-Val + H2O <=> Benzyloxycarbonate + L-valine 3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase

Pro-Val + H2O <=> L-proline + L-valine 3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.9 Xaa-Pro dipeptidase


FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> L-phenylalanine + VNQH + LCGSH + L-leucine + L-valine + L-glutamate + L-alanine + L-leucine + L-tyrosine + LVCG + ERG + L-phenylalanine + L-phenylalanine + YTPKA 3.4.23.21 rhizopuspepsin

L-valine + pyruvate + NADH <=> N-[1-(R)-(Carboxy)ethyl]-(S)-Val + NAD+ 1.5.1.28 opine dehydrogenase

L-valine + pyruvate + NADH + H+ <=> N-(1-carboxyethyl)-L-Val + NAD+ + H2O 1.5.1.22 strombine dehydrogenase

beta-Alanine + 2-oxoisovalerate <=> malonate_semialdehyde + L-valine 2.6.1.18 beta-alanine---pyruvate transaminase

valine_benzyl_ester + H2O <=> L-valine + benzyl_alcohol 3.1.1.43 alpha-amino-acid esterase

valine_benzyl_ester + H2O <=> L-valine + benzoate 3.1.1.43 alpha-amino-acid esterase

L-valine + O2 + NADPH + H+ <=> Isobutyraldoxime + NADP+ + CO2 + H2O 1.14.14.38 valine N-monooxygenase

L-2-aminobutanoate + 2-oxoisovalerate <=> 2-oxobutyrate + L-valine 2.6.1.42 branched-chain-amino-acid transaminase

L-allo-isoleucine + 2-oxoisovalerate <=> 3-methyl-2-oxopentanoate + L-valine 2.6.1.42 branched-chain-amino-acid transaminase

L-valine + 2-oxobutyrate <=> 2-oxoisovalerate + 2-aminobutanoate 2.6.1.42 branched-chain-amino-acid transaminase

L-valine + 2-oxooctanoate <=> 2-oxoisovalerate + 2-aminooctanoate 2.6.1.42 branched-chain-amino-acid transaminase

L-valine + 2-Oxohexanoate <=> 2-oxoisovalerate + 2-aminohexanoate 2.6.1.42 branched-chain-amino-acid transaminase

Val-tRNA + H2O <=> L-valine + tRNA 3.1.1.29 aminoacyl-tRNA hydrolase

Val-tRNAVal + H2O <=> L-valine + tRNAMet 3.1.1.29 aminoacyl-tRNA hydrolase

N-benzoyl-L-valine + H2O <=> benzoate + L-valine 3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase
3.5.1.32 hippurate hydrolase
3.5.1.81 N-acyl-D-amino-acid deacylase



alpha-melanocyte_stimulating_hormone + H2O <=> acetyl-SYSMEHFRWGKP + L-valine 3.4.21.26 prolyl oligopeptidase

Benzyloxycarbonyl-Gly-Val + H2O <=> Benzyloxycarbonyl-Gly + L-valine 3.4.16.5 carboxypeptidase C
3.4.17.19 carboxypeptidase Taq
3.4.22.33 fruit bromelain



L-Orn-L-Leu-D-Phe-L-Pro-L-Val-OH + H2O <=> L-ornithine + L-valine + L-Leu-D-Phe-L-Pro-OH 3.4.23.21 rhizopuspepsin

L-Valinamide + H2O <=> L-valine + NH3 3.5.1.4 amidase
3.5.1.57 tryptophanamidase


Val-Gly + H2O <=> L-valine + glycine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.13.19 membrane dipeptidase



N-benzyloxycarbonyl-Pro-Val + H2O <=> N-benzyloxycarbonyl-Pro + L-valine 3.4.16.2 lysosomal Pro-Xaa carboxypeptidase

Nalpha-tert-butoxycarbonyl-L-Val + H2O <=> tert-butanol + CO2 + L-valine 3.5.1.64 Nalpha-benzyloxycarbonylleucine hydrolase

DL-alpha-aminoisovaleronitrile + H2O <=> L-valine + NH3 3.5.5.1 nitrilase

N-carbamoyl-DL-valine + H2O <=> L-valine + CO2 + NH3 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

N-Formyl-Met-Val + H2O <=> N-formyl-L-methionine + L-valine 3.4.19.1 acylaminoacyl-peptidase
3.4.19.7 N-formylmethionyl-peptidase


N-Methyl-DL-valine + acceptor + H2O <=> L-valine + formaldehyde + reduced_acceptor 1.5.8.3 sarcosine dehydrogenase

GRGVVVGRG + H2O <=> GRGV + L-valine + L-valine + GRG 3.4.21.76 myeloblastin

L-Val-L-Lys + H2O <=> L-valine + L-lysine 3.4.13.23

L-Val-Pro-7-amido-4-carbamoylmethylcoumarin + H2O <=> L-valine + Pro-7-amido-4-carbamoylmethylcoumarin 3.4.11.9 Xaa-Pro aminopeptidase

PFU-093 + H2O <=> FITC(Ahx)-L-Val + L-valine + L-Lys-Dbc 3.4.23.12 nepenthesin

5-L-glutamyl-L-valine + Gly-Gly <=> L-valine + 5-L-glutamyl-Gly-Gly 2.3.2.2 gamma-glutamyltransferase

formyl-Gly-Val + H2O <=> N-formylglycine + L-valine 3.4.19.1 acylaminoacyl-peptidase

ATP + L-valine + L-alanine <=> ADP + phosphate + Val-Ala 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-glutamine + L-valine <=> ADP + phosphate + Gln-Val 6.3.2.49 L-alanine---L-anticapsin ligase

2 ATP + 3 L-valine <=> 2 ADP + 2 phosphate + L-valyl-L-valyl-L-valine 6.3.2.B16

ATP + L-valine + Val-Val-OH <=> ADP + phosphate + L-valyl-L-valyl-L-valine 6.3.2.B16

3 ATP + 4 L-valine <=> 3 ADP + 3 phosphate + L-valyl-L-valyl-L-valyl-L-valine 6.3.2.B16

ATP + L-valine + L-valyl-L-valyl-L-valine <=> ADP + phosphate + L-valyl-L-valyl-L-valyl-L-valine 6.3.2.B16

4 ATP + 5 L-valine <=> 4 ADP + 4 phosphate + L-valyl-L-valyl-L-valyl-L-valyl-L-valine 6.3.2.B16

ATP + Nbeta-(R,R)-trans-epoxysuccinamoyl-(2S)-2,3-diaminopropionate + L-valine <=> ADP + phosphate + 3-[[[(2R,3R)-3-carboxyoxiran-2-yl]carbonyl]amino]-L-alanyl-L-valine 6.3.2.47 dapdiamide synthase
6.3.2.B15


ATP + N3-fumaroyl-L-2,3-diaminopropanoic_acid + L-valine <=> ADP + phosphate + N-[(2S)-3-[[(2E)-4-amino-4-oxobut-2-enoyl]amino]-2-methylpropanoyl]-L-valine 6.3.2.B15

ATP + L-valine + L-arginine <=> ADP + phosphate + L-Val-L-Arg 6.3.2.B16

ATP + L-valine + L-arginyl-L-serine <=> ADP + phosphate + L-Val-L-Arg-L-Ser + L-Val-L-Val-L-Arg-L-Ser 6.3.2.B16

2 ATP + L-valine + L-arginyl-L-serine <=> 2 ADP + phosphate + L-Val-L-Arg-L-Ser 6.3.2.B16

ATP + L-valine + L-Arginine_hydroxamate <=> ADP + phosphate + L-Val-L-Arg-NHOH + L-Val-L-Val-L-Arg-NHOH 6.3.2.B16

2 ATP + L-valine + 2 L-isoleucine <=> 2 ADP + 2 phosphate + L-Val-L-Ile-L-Ile 6.3.2.B16

2 ATP + L-valine + 2 L-leucine <=> 2 ADP + 2 phosphate + L-Val-L-Leu-L-Leu 6.3.2.B16

ATP + L-valine + L-Phe-hydroxamate <=> ADP + phosphate + L-Val-L-Phe-NHOH + L-Val-L-Val-L-Phe-NHOH 6.3.2.B16

2 ATP + L-valine + L-valine + L-arginyl-L-serine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Arg-L-Ser 6.3.2.B16

2 ATP + 2 L-valine + L-asparagine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Asn 6.3.2.B16

2 ATP + 2 L-valine + L-glutamine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Gln 6.3.2.B16

2 ATP + 2 L-valine + glycine <=> 2 ADP + 2 phosphate + L-Val-L-Val-Gly 6.3.2.B16

2 ATP + 2 L-valine + L-histidine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-His 6.3.2.B16

2 ATP + 2 L-valine + L-isoleucine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Ile 6.3.2.B16

2 ATP + 2 L-valine + L-leucine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Leu 6.3.2.B16

2 ATP + 2 L-valine + L-lysine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Lys 6.3.2.B16

2 ATP + 2 L-valine + L-methionine <=> 2 ADP + 2 phosphate + VVM 6.3.2.B16

2 ATP + 2 L-valine + L-phenylalanine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Phe 6.3.2.B16

2 ATP + 2 L-valine + L-serine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Ser 6.3.2.B16

2 ATP + 2 L-valine + L-threonine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Thr 6.3.2.B16

2 ATP + 2 L-valine + L-tryptophan <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Trp 6.3.2.B16

3 ATP + 3 L-valine + L-arginine <=> 3 ADP + 3 phosphate + L-Val-L-Val-L-Val-L-Arg 6.3.2.B16

3 ATP + 3 L-valine + L-histidine <=> 3 ADP + 3 phosphate + L-Val-L-Val-L-Val-L-His 6.3.2.B16

3 ATP + 3 L-valine + L-phenylalanine <=> 3 ADP + 3 phosphate + L-Val-L-Val-L-Val-L-Phe 6.3.2.B16

ATP + Nbeta-(S,S)-trans-epoxysuccinamoyl-(2S)-2,3-diaminopropionate + L-valine <=> ADP + phosphate + Nbeta-(S,S)-trans-epoxysuccinamoyl-(2S)-2,3-diaminopropionyl-L-valine 6.3.2.B15

ATP + L-valine + beta-Alanine <=> ADP + phosphate + beta-alanyl-L-valine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-asparagine + L-valine <=> ADP + phosphate + L-asparaginyl-L-valine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-tyrosine + L-valine <=> ADP + phosphate + L-tyrosyl-L-valine 6.3.2.49 L-alanine---L-anticapsin ligase

2 ATP + L-valine + 2 an_L-amino_acid <=> 2 ADP + 2 phosphate + L-Val-(L-Baa)2 6.3.2.B16

3 ATP + 3 L-valine + an_L-amino_acid <=> 3 ADP + 3 phosphate + L-Val-L-Val-L-Val-L-amino-acid-L-Zaa 6.3.2.B16

ATP + 2 L-valine + an_L-amino_acid <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Yaa 6.3.2.B16

ATP + Nbeta-(R,R)-trans-epoxysuccinamoyl-(2S)-2,3-diaminopropionate + L-valine <=> ADP + phosphate + Nbeta-(R,R)-trans-epoxysuccinamoyl-(2S)-2,3-diaminopropionyl-L-valine 6.3.2.B15

ATP + L-methionine + L-valine <=> ADP + phosphate + Met-Val 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + H2O + L-valine-[L-valine-binding_protein][side_1] <=> ADP + phosphate + L-valine + [L-lvaline-binding_protein][side_1] 7.4.2.2 ABC-type nonpolar-amino-acid transporter

ATP + H2O + L-valine-[L-valine-binding_protein][side_1] <=> ADP + phosphate + L-valine + [L-valine-binding_protein][side_1] 7.4.2.2 ABC-type nonpolar-amino-acid transporter

ATP + 2 L-valine <=> ADP + phosphate + Val-Val-OH 6.3.2.B16

ATP + L-proline + L-valine <=> ADP + phosphate + Pro-Val 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-tryptophan + L-valine <=> ADP + phosphate + Trp-Val 6.3.2.49 L-alanine---L-anticapsin ligase

2 ATP + L-valine + 2 L-methionine <=> 2 ADP + 2 phosphate + L-Met-L-Met-L-Met 6.3.2.B16

ATP + UDP-N-acetylmuramate + L-valine <=> ADP + phosphate + UDP-N-acetylmuramoyl-L-Val 6.3.2.8 UDP-N-acetylmuramate---L-alanine ligase

3 ATP + 3 L-valine + L-glutamine <=> 3 ADP + 3 phosphate + L-Val-L-Val-L-Val-L-Gln 6.3.2.B16

2 ATP + 2 L-valine + L-alanine <=> 2 ADP + 2 phosphate + VVA 6.3.2.B16

2 ATP + 2 L-valine + L-arginine <=> 2 ADP + 2 phosphate + Val-Val-Arg 6.3.2.B16

ATP + L-histidine + L-valine <=> ADP + phosphate + L-histidyl-L-valine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-valine <=> ADP + phosphate + L-phenylalanyl-L-valine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-valine + L-serine <=> ADP + phosphate + L-valinyl-L-serine 6.3.2.49 L-alanine---L-anticapsin ligase

Met-Val + H2O <=> L-methionine + L-valine 3.4.11.18 methionyl aminopeptidase
3.4.13.12 Met-Xaa dipeptidase


2-aminobenzoyl-Phe-Arg-Val + H2O <=> 2-aminobenzoyl-Phe-Arg + L-valine 3.4.18.1 cathepsin X

Gly-Val + H2O <=> glycine + L-valine 3.4.11.1 leucyl aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase



N-lauroyl-L-valine + H2O <=> laurate + L-valine 3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase

L-Leu-L-Val + H2O <=> L-leucine + L-valine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.5.1.13 aryl-acylamidase



Val-Gly-Gly + H2O <=> L-valine + Gly-Gly 3.4.11.13 clostridial aminopeptidase
3.4.11.17 tryptophanyl aminopeptidase


Val-Trp + H2O <=> L-valine + L-tryptophan 3.4.11.16 Xaa-Trp aminopeptidase

L-2-aminoadipate + L-cystathionine + L-valine + ATP <=> N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

L-2-aminoadipate + L-cysteine + L-valine + ATP <=> N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

2-piperidone-6-carboxylate + L-cysteine + L-valine + ATP <=> N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

ATP + L-valine + tRNAVal(GAC) <=> AMP + diphosphate + L-valyl-tRNAVal(GAC) 6.1.1.9 valine---tRNA ligase

ATP + L-valine + tRNAVal(UAC) <=> AMP + diphosphate + L-valyl-tRNAVal(UAC) 6.1.1.9 valine---tRNA ligase

ATP + L-valine + tRNAVal(UAC-2) <=> AMP + diphosphate + L-valyl-tRNAVal(UAC-2) 6.1.1.9 valine---tRNA ligase

ATP + L-valine + [CmaA-protein-T-domain]-4''-phosphopantetheine <=> AMP + diphosphate + S-L-valyl-[CmaA-protein-T-domain]-4''-phosphopantetheine 6.2.1.46 L-allo-isoleucine---holo-[CmaA peptidyl-carrier protein] ligase

L-2-aminoadipate + allylglycine + L-valine + ATP <=> L-delta-(aminoadipyl)-L-allylglycinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

L-2-aminoadipate + L-Vinylglycine + L-valine + ATP <=> L-delta-(aminoadipyl)-L-vinylglycinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

L-glutamate + L-cysteine + L-valine + ATP <=> L-glutamyl-L-cysteinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

S-carboxymethyl-L-cysteine + L-cysteine + L-valine + ATP <=> L-S-carboxymethylcysteinyl-L-cysteinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

L-2-aminoadipate + L-homocysteine + L-valine + ATP <=> N-(5-amino-5-carboxypentanoyl)-L-homocysteinyl-D-valine + AMP + diphosphate 6.3.2.26 N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase

ATP + L-valine + tRNAMet <=> AMP + diphosphate + L-valyl-tRNAMetG34C36 6.1.1.5 isoleucine---tRNA ligase

ATP + L-valine + tRNAMetG34C36 <=> AMP + diphosphate + L-valyl-tRNAMetG34C36 6.1.1.10 methionine---tRNA ligase

ATP + L-valine + tRNAiMet,GAC_mutant <=> AMP + diphosphate + L-valyl-tRNAMetG34C36 6.1.1.9 valine---tRNA ligase

ATP + L-valine + tRNAVal,3''_purine_riboside <=> AMP + diphosphate + L-valyl-tRNAVal,_3''_purine_riboside 6.1.1.9 valine---tRNA ligase

ATP + L-valine + tRNAVal,3''_2-aminopurine <=> AMP + diphosphate + L-valyl-tRNAVal,_3''_2-aminopurine 6.1.1.9 valine---tRNA ligase

ATP + L-valine + tRNAVal,3''_isoguanosine <=> AMP + diphosphate + L-valyl-tRNAVal,_3''_isoguanosine 6.1.1.9 valine---tRNA ligase

ATP + L-valine + tRNAVal,3''_inosine <=> AMP + diphosphate + L-valyl-tRNAVal,_3''_inosine 6.1.1.9 valine---tRNA ligase

beta-Asp-Val + H2O <=> L-aspartate + L-valine 3.4.19.5 beta-aspartyl-peptidase