Copied!

Search

Please enter your request:
EnzymeDetector confidence threshold: Leave blank to show all results.
Does not work when no organism is selected!


Your translated search: L-tyrosine = 244 reactions were found.
State Icon Reaction EC-Number Conf. maximal confidence score from EnzymeDetector PW
H+ + L-tyrosine <=> CO2 + tyramine 4.1.1.25 tyrosine decarboxylase
4.1.1.28 aromatic-L-amino-acid decarboxylase


BMK
L-tyrosine <=> 3-amino-3-(4-hydroxyphenyl)propanoate 5.4.3.6 tyrosine 2,3-aminomutase

K
L-tyrosine + H2O <=> phenol + pyruvate + NH3 4.1.99.2 tyrosine phenol-lyase

BK
L-arogenate + NAD+ <=> L-tyrosine + CO2 + NADH 1.3.1.12 prephenate dehydrogenase
1.3.1.43 arogenate dehydrogenase
1.3.1.78 arogenate dehydrogenase (NADP+)
1.3.1.79 arogenate dehydrogenase [NAD(P)+]




MK
L-tyrosine + 2-oxoglutarate <=> 4-hydroxyphenylpyruvate + L-glutamate 2.6.1.1 aspartate transaminase
2.6.1.2 alanine transaminase
2.6.1.24 diiodotyrosine transaminase
2.6.1.27 tryptophan transaminase
2.6.1.39 2-aminoadipate transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.49 dihydroxyphenylalanine transaminase
2.6.1.5 tyrosine transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.7 kynurenine---oxoglutarate transaminase
2.6.1.79 glutamate---prephenate aminotransferase
2.6.1.9 histidinol-phosphate transaminase












BMK
L-tyrosine + L-arginine + ATP <=> H+ + L-tyrosyl-L-arginine + diphosphate + AMP 6.3.2.24 tyrosine---arginine ligase

L-arogenate + NADP+ <=> L-tyrosine + CO2 + NADPH 1.3.1.43 arogenate dehydrogenase
1.3.1.78 arogenate dehydrogenase (NADP+)
1.3.1.79 arogenate dehydrogenase [NAD(P)+]



BMK
L-tyrosine <=> p-coumaric_acid + NH3 4.3.1.23 tyrosine ammonia-lyase
4.3.1.24 phenylalanine ammonia-lyase
4.3.1.25 phenylalanine/tyrosine ammonia-lyase
5.4.3.6 tyrosine 2,3-aminomutase




MK
L-tyrosine + NADP+ + I- <=> 3-iodo-L-tyrosine + NADPH 1.21.1.1 iodotyrosine deiodinase

S-adenosyl-L-methionine + L-tyrosine + NADPH <=> 2-iminoacetate + p-Cresol + 5''-deoxyadenosine + L-methionine + NADP+ + H+ 4.1.99.19 2-iminoacetate synthase

M
L-tyrosine + O2 <=> L-Dopa 1.10.3.1 catechol oxidase
1.14.18.1 tyrosinase


MK
S-adenosyl-L-methionine + L-tyrosine <=> S-adenosyl-L-homocysteine + 3-methyl-L-tyrosine + H+ 2.1.1.304 L-tyrosine C3-methyltransferase

M
dimethylallyl_diphosphate + L-tyrosine <=> diphosphate + 4-O-dimethylallyl-L-tyrosine 2.5.1.122 4-O-dimethylallyl-L-tyrosine synthase

L-tyrosine + O2 + H2O <=> 4-hydroxyphenylacetaldehyde + CO2 + NH3 + H2O2 4.1.1.108 4-hydroxyphenylacetaldehyde synthase

K
L-tyrosine + D-ribulose_5-phosphate <=> (2S)-3-(4-hydroxyphenyl)-2-isocyanopropanoate + Hydroxyacetone + phosphate + formaldehyde + H2O + H+ 4.1.99.24 L-tyrosine isonitrile synthase

M
S-adenosyl-L-methionine + 5-amino-6-ribitylamino-2,4(1H,3H)-pyrimidinedione + L-tyrosine <=> 5-amino-5-(4-hydroxybenzyl)-6-(D-ribitylimino)-5,6-dihydrouracil + 2-iminoacetate + 5''-deoxyadenosine + L-methionine + H+ 2.5.1.147 5-amino-6-(D-ribitylamino)uracil---L-tyrosine 4-hydroxyphenyl transferase

MK
AMP + diphosphate + NADP+ + L-tyrosinal <=> ATP + NADPH + L-tyrosine + H+ 1.2.1.101 L-tyrosine reductase

L-tyrosine + H2O + O2 <=> 4-hydroxyphenylpyruvate + NH3 + H2O2 1.4.3.11 L-glutamate oxidase
1.4.3.14 L-lysine oxidase
1.4.3.2 L-amino-acid oxidase



K
L-tyrosine + pyruvate <=> 4-hydroxyphenylpyruvate + L-alanine 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.5 tyrosine transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.58 phenylalanine(histidine) transaminase





BMK
L-tyrosine + phenylpyruvate <=> 4-hydroxyphenylpyruvate + L-phenylalanine 2.6.1.28 tryptophan---phenylpyruvate transaminase
2.6.1.5 tyrosine transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.70 aspartate---phenylpyruvate transaminase





M
phosphotyrosine + H2O <=> L-tyrosine + phosphate 3.1.3.1 alkaline phosphatase
3.1.3.100 thiamine phosphate phosphatase
3.1.3.16 protein-serine/threonine phosphatase
3.1.3.2 acid phosphatase
3.1.3.3 phosphoserine phosphatase
3.1.3.48 protein-tyrosine-phosphatase
3.1.3.60 phosphoenolpyruvate phosphatase
3.1.3.8 3-phytase








tyrosinated_tubulin + H2O <=> tubulin + L-tyrosine 3.4.17.17 tubulinyl-Tyr carboxypeptidase

L-tyrosine + O2 + FADH2 <=> L-Dopa + H2O + FAD + H+ 1.14.14
1.14.14.9 4-hydroxyphenylacetate 3-monooxygenase


M
ATP + detyrosinated_alpha-tubulin + L-tyrosine <=> alpha-tubulin + ADP + phosphate 6.3.2.25 tubulin---tyrosine ligase

L-tyrosine + O2 + flavin_hydroquinone <=> N-hydroxy-L-tyrosine + [oxidized_NADPH-hemoprotein_reductase] + H2O 1.14.14.36 tyrosine N-monooxygenase

K
ATP + L-tyrosine + tRNAMet <=> AMP + diphosphate + L-tyrosyl-tRNATyr 6.1.1.1 tyrosine---tRNA ligase

BK
L-tyrosine + tetrahydropteridine + O2 <=> L-Dopa + a_4a-hydroxy-5,6,7,8-tetrahydropteridine 1.14.16.2 tyrosine 3-monooxygenase

B
L-phenylalanine + tetrahydropteridine + O2 <=> L-tyrosine + a_4a-hydroxy-5,6,7,8-tetrahydropteridine 1.14.16.1 phenylalanine 4-monooxygenase

L-tyrosine + 2 O2 + 2 flavin_hydroquinone <=> p-hydroxyphenylacetaldoxime + 2 [oxidized_NADPH-hemoprotein_reductase] + CO2 + 3 H2O 1.14.14.36 tyrosine N-monooxygenase
1.14.14.40 phenylalanine N-monooxygenase


K
4-hydroxyphenylglyoxylate + L-tyrosine <=> L-4-hydroxyphenylglycine + 4-hydroxyphenylpyruvate 2.6.1.103 (S)-3,5-dihydroxyphenylglycine transaminase
2.6.1.B17


K
L-tyrosine + H2O + NAD+ <=> 4-hydroxyphenylpyruvate + NH3 + NADH 1.4.1.20 phenylalanine dehydrogenase
1.4.1.5 L-amino-acid dehydrogenase


K
L-phenylalanine + tetrahydrobiopterin + O2 <=> L-tyrosine + dihydrobiopterin + H2O 1.14.16.1 phenylalanine 4-monooxygenase
1.14.16.4 tryptophan 5-monooxygenase


K
L-tyrosine + tetrahydrobiopterin + O2 <=> L-Dopa + dihydrobiopterin + H2O 1.14.16.2 tyrosine 3-monooxygenase

K
L-tyrosine + tetrahydrobiopterin + O2 <=> L-Dopa + 4a-hydroxytetrahydrobiopterin 1.14.16.2 tyrosine 3-monooxygenase

K
L-phenylalanine + tetrahydrobiopterin + O2 <=> L-tyrosine + 4a-hydroxytetrahydrobiopterin 1.14.16.1 phenylalanine 4-monooxygenase

K
L-tyrosine + L-Dopa + O2 <=> L-Dopa + dopaquinone + H2O 1.10.3.1 catechol oxidase
1.14.18.1 tyrosinase


K
L-tyrosine + S-adenosyl-L-methionine + reduced_acceptor <=> 2-iminoacetate + p-Cresol + 5''-deoxyadenosine + L-methionine + acceptor + 2 H+ 4.1.99.19 2-iminoacetate synthase

K
L-tyrosine <=> (S)-beta-tyrosine 5.4.3.6 tyrosine 2,3-aminomutase

K
L-tyrosine + Betalamate <=> H+ + Portulacaxanthin_II + H2O not assigned

MK
L-tyrosine + O2 <=> dopaquinone + H2O 1.14.18.1 tyrosinase

M
Benzyloxycarbonyl-Gly-Tyr + H2O <=> Benzyloxycarbonyl-Gly + L-tyrosine 3.4.17.1 carboxypeptidase A
3.4.17.15 carboxypeptidase A2
3.4.22.33 fruit bromelain



Tyr-Leu + H2O <=> L-tyrosine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.23 PepB aminopeptidase
3.4.13.19 membrane dipeptidase
3.4.19.1 acylaminoacyl-peptidase
3.4.24.54 mucrolysin






Gly-Tyr + H2O <=> glycine + L-tyrosine 3.4.11.1 leucyl aminopeptidase
3.4.11.16 Xaa-Trp aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.17.1 carboxypeptidase A
3.4.24.54 mucrolysin
3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase






N-acetyl-L-tyrosine + H2O <=> L-tyrosine + acetate 3.5.1.114 N-acyl-aromatic-L-amino acid amidohydrolase
3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase
3.5.1.87 N-carbamoyl-L-amino-acid hydrolase



L-phenylalanine + 6-Methyl-5,6,7,8-tetrahydropterin + O2 <=> L-tyrosine + 6-methyldihydropterin + H2O 1.14.16.1 phenylalanine 4-monooxygenase
1.14.16.2 tyrosine 3-monooxygenase
1.14.16.4 tryptophan 5-monooxygenase



L-tyrosine + glyoxylate <=> 4-hydroxyphenylpyruvate + glycine 2.6.1.44 alanine---glyoxylate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.60 aromatic-amino-acid---glyoxylate transaminase
2.6.1.63 kynurenine---glyoxylate transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.7 kynurenine---oxoglutarate transaminase






Tyr-Phe + H2O <=> L-tyrosine + L-phenylalanine 3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.13.19 membrane dipeptidase
3.4.19.1 acylaminoacyl-peptidase





Phe-Tyr + H2O <=> L-phenylalanine + L-tyrosine 3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.22 aminopeptidase I
3.4.13.19 membrane dipeptidase



Ala-Tyr + H2O <=> L-alanine + L-tyrosine 3.4.13.20 beta-Ala-His dipeptidase

His-Pro-Tyr + H2O <=> His-Pro + L-tyrosine 3.4.14.11 Xaa-Pro dipeptidyl-peptidase
3.4.14.5 dipeptidyl-peptidase IV


Tyr-Gly + H2O <=> L-tyrosine + glycine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase



Tyr-Gly-Gly + H2O <=> L-tyrosine + Gly-Gly 3.4.11.4 tripeptide aminopeptidase
3.4.15.1 peptidyl-dipeptidase A


Tyr-Ala + H2O <=> L-tyrosine + L-alanine 3.4.17.6 alanine carboxypeptidase

Hydroiodic_acid + 3-iodo-L-tyrosine <=> Iodine + L-tyrosine 1.11.1.8 iodide peroxidase

K
3''-Amino-3''-deoxy-AMP + L-tyrosine <=> N6,N6,O-Tridemethylpuromycin-5''-phosphate not assigned

K
L-tyrosine + pC3'p + ATP <=> L-Tyrosyl-[pcp] + AMP + diphosphate not assigned

K
ATP + detyrosinated_alpha-tubulin + L-tyrosine <=> tyrosinated_alpha-tubulin + ADP + phosphate + H+ 6.3.2.25 tubulin---tyrosine ligase

indole-3-acetic_acid + L-tyrosine + ATP <=> H+ + (indol-3-yl)acetyl-L-tyrosine + AMP + diphosphate 6.3

L-glutamate + L-tyrosine + L-2,4-diaminobutanoate + L-serine + L-arginine + N5-formyl-N5-hydroxy-L-ornithine + L-lysine + L-threonine + myristoyl-CoA + ATP <=> myristoylated_ferribactin + CoA + H2O + AMP + diphosphate + H+ 6.3.2

M
L-tyrosine + O2 + reduced_[NADPH-hemoprotein_reductase] <=> p-hydroxyphenylacetaldoxime + oxidized_[NADPH-hemoprotein_reductase] + CO2 + H2O 1.14.14.36 tyrosine N-monooxygenase

L-phenylalanine + 10-formyltetrahydrofolate + O2 <=> 4a-hydroxy-N10-formyltetrahydrofolate + L-tyrosine 1.14.16.1 phenylalanine 4-monooxygenase

M
NovH_peptidyl-carrier_protein + L-tyrosine + ATP <=> L-tyrosine-S-[NovH_protein] + AMP + diphosphate not assigned

M
L-tyrosine <=> phenol + 2-aminoacrylate not assigned

6,8-dimethyl-3-oxo-4,6-decadienoyl-[acp] + L-tyrosine + ATP <=> pretenellin_A + [acyl-carrier_protein] + H+ + AMP + diphosphate 6.3.2

M
10-methyl-3-oxo-4,6,8-dodecatrienoyl-[acp] + ATP + L-tyrosine <=> predesmethylbassianin_A + AMP + diphosphate + [acyl-carrier_protein] + H+ 6.3.2

M
8,10-dimethyl-3-oxo-4,6,8-dodecatrienoyl-[acp] + ATP + L-tyrosine <=> prebassianin_A + AMP + diphosphate + [acyl-carrier_protein] + H+ 6.3.2

M
4,6-dimethyl-3-oxooctanoyl-[acp] + L-tyrosine + ATP <=> preaspyridone_A + AMP + diphosphate + [acyl-carrier_protein] + H+ 6.3.2

M
(5E,7E,9E,11E,13E)-3,7,11,13-tetramethylpentadeca-5,7,9,11,13-pentaene-2,4-dioyl-[acp] + L-tyrosine + ATP <=> fusaridione_A + [acyl-carrier_protein] + AMP + diphosphate + H+ 6.3.2

M
3''-amino-3''-deoxyadenosine + L-tyrosine <=> N6,N6,O-tridemethylpuromycin + H2O not assigned

M
L-tyrosine <=> L-tyrosine not assigned

L-phenylalanine + O2 + tetrahydropteridine <=> L-tyrosine + 4a-hydroxytetrahydropteridine 1.14.16.1 phenylalanine 4-monooxygenase

M
ATP + H2O + L-tyrosine <=> ADP + phosphate + L-tyrosine + H+ 7.4.2.n

H+ + L-tyrosine <=> H+ + L-tyrosine not assigned

tRNAMet + L-tyrosine + ATP <=> L-tyrosyl-[tRNATyr] + diphosphate + AMP 6.1.1.1 tyrosine---tRNA ligase

M
L-tyrosine + tetrahydropteridine + O2 <=> L-Dopa + 4a-hydroxytetrahydropteridine 1.14.16.2 tyrosine 3-monooxygenase

M
L-tyrosine + O2 + reduced_[NADPH-hemoprotein_reductase] <=> N-hydroxy-L-tyrosine + H2O + oxidized_[NADPH-hemoprotein_reductase] + H+ not assigned

M
4-hydroxyphenylpyruvate + L-tyrosine <=> L-tyrosine + 4-hydroxyphenylpyruvate 2.6.1.57 aromatic-amino-acid transaminase

Benzyloxycarbonyl-Phe-Tyr + H2O <=> benzyloxycarbonyl-Phe + L-tyrosine 3.4.16.5 carboxypeptidase C
3.4.17.19 carboxypeptidase Taq
3.4.23.26 rhodotorulapepsin



L-tyrosyl-L-arginine + H2O <=> L-tyrosine + L-arginine 3.4.11.2 membrane alanyl aminopeptidase

Tyr-Pro-Phe-Pro-Gly-Pro-Ile + H2O <=> L-tyrosine + Pro-Phe-Pro-Gly-Pro-Ile 3.4.13.9 Xaa-Pro dipeptidase

L-phenylalanine + 6,7-dimethyltetrahydrobiopterin + O2 <=> L-tyrosine + 6,7-dimethyl-4a-hydroxy-tetrahydrobiopterin 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + tetrahydrobiopterin + O2 <=> L-tyrosine + L-threo-7,8-dihydrobiopterin + H2O 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + tetrahydrobiopterin + O2 <=> L-tyrosine + DL-m-Tyr + dihydropteridine + H2O 1.14.16.2 tyrosine 3-monooxygenase

L-phenylalanine + 6-methyl-tetrahydrobiopterin + O2 <=> L-tyrosine + 6-methyl-4a-hydroxytetrahydrobiopterin 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + 6,7-dimethyltetrahydropterin + O2 <=> L-tyrosine + 4a-hydroxytetrahydrobiopterin 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + tetrahydropteridine + O2 <=> L-tyrosine + dihydropteridine + H2O 1.14.16.2 tyrosine 3-monooxygenase
1.14.16.4 tryptophan 5-monooxygenase


L-phenylalanine + 6,7-dimethyl-5,6,7,8-tetrahydrobiopterin + O2 <=> L-tyrosine + 7,8-dimethyl-6,7-dihydrobiopterin + H2O 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + 6-Methyl-5,6,7,8-tetrahydropterin + O2 <=> L-tyrosine + 4a-hydroxy-6-methyltetrahydropterin 1.14.16.1 phenylalanine 4-monooxygenase

4-hydroxyphenylpyruvate + L-tryptophan <=> L-tyrosine + 3-Indole-2-oxopropanoate 2.6.1.28 tryptophan---phenylpyruvate transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.99 L-tryptophan---pyruvate aminotransferase



GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 + H2O <=> Gly-Trp-Thr + Leu-Asn-Ser + Ala-Gly + L-tyrosine + L-leucine + LGPHAIDNHRS + FHDKYG + Leu-Ala-NH2 3.4.24.29 aureolysin

Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr + H2O <=> Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val + L-tyrosine 3.4.17.B4
3.4.17.B5


L-Tyr-2-naphthylamide + H2O <=> L-tyrosine + 2-Naphthylamine 3.4.11.2 membrane alanyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.11.6 aminopeptidase B
3.4.19.1 acylaminoacyl-peptidase
3.5.1.57 tryptophanamidase






DL-phosphotyrosine + H2O <=> L-tyrosine + phosphate 3.1.3.1 alkaline phosphatase

L-leucine + 4-hydroxyphenylpyruvate <=> 4-methyl-2-oxopentanoate + L-tyrosine 2.6.1.42 branched-chain-amino-acid transaminase

N-benzyloxycarbonyl-Ala-Tyr + H2O <=> Benzyloxycarbonyl-Ala + L-tyrosine 3.4.17.B4
3.4.17.B5


D-tyrosine <=> L-tyrosine 5.1.1.10 amino-acid racemase

L-Tyr-7-amido-4-carbamoylmethylcoumarin + H2O <=> L-tyrosine + 7-amino-4-carbamoylmethylcoumarin 3.4.11.2 membrane alanyl aminopeptidase

L-Ala-L-Pro-L-Tyr + H2O <=> Ala-Pro + L-tyrosine 3.4.14.11 Xaa-Pro dipeptidyl-peptidase

YPWTQ + H2O <=> L-tyrosine + PWTQ 3.4.11.9 Xaa-Pro aminopeptidase

dimethylallyl_diphosphate + L-tyrosine <=> diphosphate + 5-(2-trans-pentenyl)-L-tryptophan 2.5.1.80 7-dimethylallyltryptophan synthase

dimethylallyl_diphosphate + L-tyrosine <=> diphosphate + 3-(3-methylbut-2-enyl)-L-Tyr 2.5.1.34 4-dimethylallyltryptophan synthase
2.5.1.B31


2-pentenyl_diphosphate + L-tyrosine <=> diphosphate + 4-O-(2-pentenyl)-L-tyrosine 2.5.1.122 4-O-dimethylallyl-L-tyrosine synthase

methylallyl_diphosphate + L-tyrosine <=> diphosphate + 4-O-methylallyl-L-tyrosine 2.5.1.122 4-O-dimethylallyl-L-tyrosine synthase

Gly-Leu-Tyr + H2O <=> Gly-Leu + L-tyrosine 3.4.23.26 rhodotorulapepsin

alpha-tubulin + H2O <=> untyrosinated_tubulin + L-tyrosine 3.4.17.17 tubulinyl-Tyr carboxypeptidase

insulin_chain_B_fragment_22-30 + H2O <=> RGFF + L-tyrosine + TPKA 3.4.24.B2

L-tyrosine + phenylacetamide <=> N-(phenylacetyl)-L-tyrosine + NH3 3.5.1.11 penicillin amidase

N-carbamoyl-L-tyrosine + H2O <=> L-tyrosine + CO2 + NH3 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

L-tyrosine + H2O <=> 4-hydroxyphenylacetaldehyde + CO2 + NH3 4.1.1.25 tyrosine decarboxylase

L-tyrosine + H2O + 2 cytochrome_b <=> 4-hydroxyphenylpyruvate + NH3 + 2 reduced_cytochrome_b 1.4.99.B3

L-tyrosine + O2 <=> 4-hydroxyphenylpyruvate + NH3 1.13.12.15 3,4-dihydroxyphenylalanine oxidative deaminase

Ser-Tyr-NH2 + H2O <=> L-serine + L-tyrosine + NH3 3.4.14.1 dipeptidyl-peptidase I

L-tyrosine + O2 <=> 4-Hydroxyphenylacetamide + CO2 + H2O 1.13.12.3 tryptophan 2-monooxygenase

Met-enkephalin + H2O <=> L-tyrosine + Gly-Gly-Phe-Met 3.4.11.2 membrane alanyl aminopeptidase

N-methyl-L-tyrosine + O2 + H2O <=> L-tyrosine + formaldehyde + H2O2 1.5.3.2 N-methyl-L-amino-acid oxidase

L-tyrosine + H2O2 + I- <=> 3-iodo-L-tyrosine + 3,5-diiodo-L-tyrosine + H2O 1.11.1.8 iodide peroxidase

5''-phospho-pyridoxyl-L-tyrosine + H2O + O2 <=> pyridoxal_5''-phosphate + L-tyrosine + H2O2 1.4.3.5 pyridoxal 5'-phosphate synthase

L-tyrosine_amide + H2O <=> L-tyrosine + NH3 3.4.11.17 tryptophanyl aminopeptidase
3.5.1.101 L-proline amide hydrolase
3.5.1.57 tryptophanamidase



Tyrosine_O-sulfate + H2O <=> L-tyrosine + sulfate 3.1.6.1 arylsulfatase
3.1.6.8 cerebroside-sulfatase


L-tyrosine + Br- + H2O2 <=> 3-bromo-L-Tyr + dibromotyrosine 1.11.1.10 chloride peroxidase

Trp-Tyr + H2O <=> L-tryptophan + L-tyrosine 3.4.11.17 tryptophanyl aminopeptidase

5-L-glutamyl-L-tyrosine <=> 5-oxoproline + L-tyrosine 4.3.2.9 gamma-glutamylcyclotransferase

Leu-enkephalin + H2O <=> L-tyrosine + L-leucine 3.1.1.7 acetylcholinesterase

Leu-enkephalin + H2O <=> L-tyrosine + Gly-Gly-Phe-Leu 3.4.11.15 aminopeptidase Y
3.4.11.2 membrane alanyl aminopeptidase


benzyloxycarbonyl-Gly-Gly-Tyr + H2O <=> benzyloxycarbonyl-Gly-Gly + L-tyrosine 3.4.17.1 carboxypeptidase A

2-oxosuccinamic_acid + L-tyrosine <=> L-asparagine + 4-hydroxyphenylpyruvate 2.6.1.14 asparagine---oxo-acid transaminase

L-Tyr-D-Leu + H2O <=> L-tyrosine + D-Leu 3.4.13.19 membrane dipeptidase

L-tyrosine + 6-methyl-tetrahydrobiopterin + O2 <=> L-Dopa + 6-methyl-4a-hydroxytetrahydrobiopterin 1.14.16.2 tyrosine 3-monooxygenase

L-tyrosine + O2 + reduced_acceptor <=> L-Dopa + H2O + A 1.14.18.1 tyrosinase

L-tyrosine + ascorbate + O2 <=> L-Dopa + dehydroascorbate + H2O 1.14.16.2 tyrosine 3-monooxygenase
1.14.17.B1


L-tyrosine + tetrahydrobiopterin + O2 <=> L-Dopa + 4a-hydroxytetrahydro-L-biopterin 1.14.16.2 tyrosine 3-monooxygenase

L-tyrosine + tetrahydrobiopterin + O2 <=> L-Dopa + dihydropteridine + H2O 1.14.16.2 tyrosine 3-monooxygenase

L-tyrosine + tetrahydropteridine + O2 <=> L-Dopa + dihydropteridine + H2O 1.14.16.2 tyrosine 3-monooxygenase

L-tyrosine + H2O <=> L-Dopa 4.1.99.2 tyrosine phenol-lyase

L-tyrosine + H2O2 <=> L-Dopa 1.14.18.1 tyrosinase

Leu-Tyr + H2O <=> L-leucine + L-tyrosine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.23 PepB aminopeptidase
3.4.22.6 chymopapain
3.4.24.54 mucrolysin
3.5.1.13 aryl-acylamidase







L-pyroglutamyl-Tyr + H2O <=> 5-oxoproline + L-tyrosine 3.4.19.3 pyroglutamyl-peptidase I

L-kynurenine + 4-hydroxyphenylpyruvate <=> Kynurenic_acid + L-tyrosine 2.6.1.7 kynurenine---oxoglutarate transaminase

L-Histidinol_phosphate + 4-hydroxyphenylpyruvate <=> 3-(Imidazol-4-yl)-2-oxopropyl_phosphate + L-tyrosine 2.6.1.9 histidinol-phosphate transaminase

L-tyrosine + 2-oxobutyrate <=> 4-hydroxyphenylpyruvate + 2-aminobutanoate 2.6.1.7 kynurenine---oxoglutarate transaminase

L-2-aminoadipate + 4-hydroxyphenylpyruvate <=> 2-oxoadipate + L-tyrosine 2.6.1.39 2-aminoadipate transaminase

L-tyrosine + 2-Oxopentanoate <=> 4-hydroxyphenylpyruvate + L-norvaline 2.6.1.5 tyrosine transaminase

L-tyrosine + 2-Oxohexanoate <=> 4-hydroxyphenylpyruvate + L-norleucine 2.6.1.5 tyrosine transaminase

prephenate + L-tyrosine <=> L-arogenate + 4-hydroxyphenylpyruvate 2.6.1.57 aromatic-amino-acid transaminase

L-Tyr-L-Glu + H2O <=> L-tyrosine + L-glutamate 3.4.17.11 glutamate carboxypeptidase

L-tyrosine + 2-oxoglutarate <=> phenylpyruvate + L-glutamate 2.6.1.26 thyroid-hormone transaminase

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> FVNQHLCGSH + LVEA + L-leucine + L-tyrosine + LVCGERGF + FYTPKA 3.4.23.18 aspergillopepsin I

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> FVNQHL + CGSHLVE + Ala-Leu + L-tyrosine + LVCGERGF + FYTPKA 3.4.23.12 nepenthesin

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + 3 H2O <=> FVNQHLCGSHLVEAL + L-tyrosine + LVCGERGF + FYTPKA 3.4.23.18 aspergillopepsin I

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> L-phenylalanine + VNQH + LCGSH + L-leucine + L-valine + L-glutamate + L-alanine + L-leucine + L-tyrosine + LVCG + ERG + L-phenylalanine + L-phenylalanine + YTPKA 3.4.23.21 rhizopuspepsin

L-phenylalanine + NADH + O2 <=> L-tyrosine + NAD+ + H2O 1.14.13.25 methane monooxygenase (soluble)

Tyr-Pro + H2O <=> L-tyrosine + L-proline 3.4.13.9 Xaa-Pro dipeptidase

N-Acetyl-DL-tyrosine + H2O <=> acetate + L-tyrosine 3.5.1.15 aspartoacylase

oxidized_insulin_B-chain + H2O <=> FVNQHLCGSHLVEAL + L-tyrosine + LVCGERGFFYTPKA 3.4.23.1 pepsin A

L-tyrosine + H2O2 <=> dityrosine + H2O 1.11.2.2 myeloperoxidase

Benzyloxycarbonyl-Glu-Tyr + H2O <=> Benzyloxycarbonyl-Glu + L-tyrosine 3.4.16.5 carboxypeptidase C
3.4.17.4 Gly-Xaa carboxypeptidase
3.4.21.25 cucumisin
3.4.22.6 chymopapain
3.4.23.26 rhodotorulapepsin
3.4.24.12 envelysin






neuropeptide_Y3-36 + H2O <=> neuropeptide_Y3-35 + L-tyrosine 3.4.21.34 plasma kallikrein

L-tyrosine + 2 NADP+ + 2 Cl- <=> 3,5-dichloro-L-tyrosine + 2 NADPH + 2 H+ 1.21.1.1 iodotyrosine deiodinase

3-chloro-L-tyrosine + NADPH + H+ <=> L-tyrosine + NADP+ + Cl- 1.21.1.1 iodotyrosine deiodinase

L-tyrosine + 2 NADP+ + 2 Br- <=> 3,5-Dibromo-L-tyrosine + 2 NADPH + 2 H+ 1.21.1.1 iodotyrosine deiodinase

3-bromo-L-Tyr + NADPH + H+ <=> L-tyrosine + NADP+ + Br- 1.21.1.1 iodotyrosine deiodinase

L-phenylalanine + NADPH + O2 <=> L-tyrosine + NADP+ + H2O 1.14.13.25 methane monooxygenase (soluble)

4-hydroxyphenylpyruvate + NADPH + NH3 <=> L-tyrosine + NADP+ + H2O 1.4.1.2 glutamate dehydrogenase

L-tyrosine + O2 <=> dopachrome + H2O 1.14.18.1 tyrosinase

Tyr-tRNA + H2O <=> L-tyrosine + tRNA 3.1.1.29 aminoacyl-tRNA hydrolase

L-tyrosine_benzyl_ester + H2O <=> benzyl_alcohol + L-tyrosine 3.1.1.70 cetraxate benzylesterase

L-tyrosine_benzyl_ester + H2O <=> L-tyrosine + benzoate 3.1.1.43 alpha-amino-acid esterase

alpha-L-Glu-L-Tyr + H2O <=> L-glutamate + L-tyrosine 3.4.11.16 Xaa-Trp aminopeptidase

3''-phosphoadenylylsulfate + L-tyrosine <=> adenosine_3'',5''-bisphosphate + Tyrosine_O-sulfate 2.8.2.1 aryl sulfotransferase
2.8.2.9 tyrosine-ester sulfotransferase


L-Tyr-D-Arg + H2O <=> L-tyrosine + D-arginine 3.4.13.17 non-stereospecific dipeptidase

L-tyrosine + Cl- + H2O2 <=> 3-chloro-L-tyrosine + dichlorotyrosine 1.11.1.10 chloride peroxidase

L-tyrosine + Cl- + H2O2 + H+ <=> 3-chloro-L-tyrosine + H2O 1.11.2.2 myeloperoxidase

L-tyrosine_propyl_ester + H2O <=> L-tyrosine + 1-propanol 3.1.1.43 alpha-amino-acid esterase

L-leucine + L-arginine <=> L-tyrosine + glycine 3.1.1.7 acetylcholinesterase