Copied!

Search

Please enter your request:
EnzymeDetector confidence threshold: Leave blank to show all results.
Does not work when no organism is selected!


Your translated search: L-phenylalanine = 369 reactions were found.
State Icon Reaction EC-Number Conf. maximal confidence score from EnzymeDetector PW
H2O + L-phenylalanine + ATP <=> H+ + D-Phe + diphosphate + AMP 5.1.1.11 phenylalanine racemase (ATP-hydrolysing)

H+ + L-phenylalanine <=> 2-Phenylethylamine + CO2 4.1.1.14 valine decarboxylase
4.1.1.19 arginine decarboxylase
4.1.1.25 tyrosine decarboxylase
4.1.1.28 aromatic-L-amino-acid decarboxylase
4.1.1.53 phenylalanine decarboxylase





L-phenylalanine + NAD+ + H2O <=> phenylpyruvate + NH3 + NADH + H+ 1.4.1.1 alanine dehydrogenase
1.4.1.19 tryptophan dehydrogenase
1.4.1.20 phenylalanine dehydrogenase
1.4.1.5 L-amino-acid dehydrogenase
1.4.1.8 valine dehydrogenase (NADP+)
1.4.1.9 leucine dehydrogenase






L-phenylalanine <=> Cinnamic_acid + NH3 4.3.1.1 aspartate ammonia-lyase
4.3.1.23 tyrosine ammonia-lyase
4.3.1.24 phenylalanine ammonia-lyase
4.3.1.25 phenylalanine/tyrosine ammonia-lyase
4.3.1.31 L-tryptophan ammonia lyase
4.3.1.5 phenylalanine ammonia-lyase






L-phenylalanine + O2 <=> phenylacetamide + CO2 + H2O 1.11.1.21 catalase-peroxidase
1.13.12.3 tryptophan 2-monooxygenase
1.13.12.9 phenylalanine 2-monooxygenase



L-phenylalanine + acetyl-CoA <=> H+ + N-acetyl-L-phenylalanine + CoA 2.3.1.53 phenylalanine N-acetyltransferase

L-phenylalanine + pyruvate <=> phenylpyruvate + L-alanine 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.15 glutamine---pyruvate transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.58 phenylalanine(histidine) transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase







L-tryptophan + phenylpyruvate <=> 3-Indole-2-oxopropanoate + L-phenylalanine 2.6.1.28 tryptophan---phenylpyruvate transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.70 aspartate---phenylpyruvate transaminase
2.6.1.99 L-tryptophan---pyruvate aminotransferase





L-glutamine + phenylpyruvate <=> 2-Oxoglutaramate + L-phenylalanine 2.6.1.14 asparagine---oxo-acid transaminase
2.6.1.15 glutamine---pyruvate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.58 phenylalanine(histidine) transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase





phenylpyruvate + L-aspartate <=> L-phenylalanine + oxaloacetate 2.6.1.27 tryptophan transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.70 aspartate---phenylpyruvate transaminase
2.6.1.78 aspartate---prephenate aminotransferase




H+ + L-arogenate <=> CO2 + H2O + L-phenylalanine 4.2.1.51 prephenate dehydratase
4.2.1.91 arogenate dehydratase


angiotensin_II + H2O <=> angiotensin-(1-7) + L-phenylalanine 3.4.17.15 carboxypeptidase A2
3.4.17.23 angiotensin-converting enzyme 2
3.4.21.26 prolyl oligopeptidase



L-phenylalanine <=> (S)-beta-phenylalanine 5.4.3.10 phenylalanine aminomutase (L-beta-phenylalanine forming)
5.4.3.11 phenylalanine aminomutase (D-beta-phenylalanine forming)


S-adenosyl-L-methionine + ATP + anthranilate + L-phenylalanine <=> cyclopeptine + AMP + diphosphate + S-adenosyl-L-homocysteine + H+ 6.3.2.40 cyclopeptine synthase

H+ + L-phenylalanine + O2 + H2O <=> phenylacetaldehyde + NH3 + H2O2 + CO2 4.1.1.109 phenylacetaldehyde synthase

L-phenylalanine + O2 + H2O <=> phenylpyruvate + NH3 + H2O2 + H+ 1.13.12.9 phenylalanine 2-monooxygenase
1.4.3.14 L-lysine oxidase
1.4.3.2 L-amino-acid oxidase



L-phenylalanine + 2-oxoglutarate <=> phenylpyruvate + L-glutamate 2.6.1.1 aspartate transaminase
2.6.1.24 diiodotyrosine transaminase
2.6.1.27 tryptophan transaminase
2.6.1.39 2-aminoadipate transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.5 tyrosine transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.60 aromatic-amino-acid---glyoxylate transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.7 kynurenine---oxoglutarate transaminase
2.6.1.70 aspartate---phenylpyruvate transaminase
2.6.1.79 glutamate---prephenate aminotransferase
2.6.1.9 histidinol-phosphate transaminase













L-methionine + phenylpyruvate <=> 4-methylsulfanyl-2-oxobutanoate + L-phenylalanine 2.6.1.14 asparagine---oxo-acid transaminase
2.6.1.15 glutamine---pyruvate transaminase
2.6.1.28 tryptophan---phenylpyruvate transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.58 phenylalanine(histidine) transaminase
2.6.1.60 aromatic-amino-acid---glyoxylate transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.88 methionine transaminase










L-tyrosine + phenylpyruvate <=> 4-hydroxyphenylpyruvate + L-phenylalanine 2.6.1.28 tryptophan---phenylpyruvate transaminase
2.6.1.5 tyrosine transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.70 aspartate---phenylpyruvate transaminase





L-phenylalanine + ATP + H2O <=> L-phenylalanine + ADP + phosphate + H+ 7.4.2.1 ABC-type polar-amino-acid transporter
7.4.2.2 ABC-type nonpolar-amino-acid transporter


jasmonic_acid + L-phenylalanine + ATP <=> H+ + jasmonoyl-L-phenylalanine + AMP + diphosphate 6.3.2.52 jasmonoyl---L-amino acid synthetase
6.3.2.z


L-phenylalanine + tetrahydropteridine + O2 <=> L-tyrosine + a_4a-hydroxy-5,6,7,8-tetrahydropteridine 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + 2 flavin_hydroquinone + 2 O2 <=> (E)-phenylacetaldoxime + 2 [oxidized_NADPH-hemoprotein_reductase] + CO2 + 3 H2O 1.14.14.40 phenylalanine N-monooxygenase

L-phenylalanine + flavin_hydroquinone + O2 <=> N-hydroxy-L-phenylalanine + [oxidized_NADPH-hemoprotein_reductase] + H2O 1.14.14.40 phenylalanine N-monooxygenase

L-phenylalanine + tetrahydropteridine + O2 <=> L-m-Tyr + a_4a-hydroxy-5,6,7,8-tetrahydropteridine 1.14.16.7 phenylalanine 3-monooxygenase

ATP + L-phenylalanine + tRNAMet <=> AMP + diphosphate + L-phenylalanyl-tRNAPhe 6.1.1.20 phenylalanine---tRNA ligase

L-phenylalanine + tetrahydrobiopterin + O2 <=> L-tyrosine + dihydrobiopterin + H2O 1.14.16.1 phenylalanine 4-monooxygenase
1.14.16.4 tryptophan 5-monooxygenase


L-phenylalanine + tetrahydrobiopterin + O2 <=> L-tyrosine + 4a-hydroxytetrahydrobiopterin 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + tetrahydrobiopterin + O2 <=> L-m-Tyr + 4a-hydroxytetrahydrobiopterin 1.14.16.7 phenylalanine 3-monooxygenase

3-[(2S,5R)-5-hydroxy-7-oxabicyclo[4.1.0]heptan-2-yl]-2-oxopropanoate + L-phenylalanine <=> L-dihydroanticapsin + phenylpyruvate 2.6.1

N-acetyl-L-phenylalanine + H2O <=> acetate + L-phenylalanine 3.5.1.114 N-acyl-aromatic-L-amino acid amidohydrolase
3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase
3.5.1.15 aspartoacylase
3.5.1.87 N-carbamoyl-L-amino-acid hydrolase




L-Phe-4-nitroanilide + H2O <=> L-phenylalanine + 4-nitroaniline 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.11.24 aminopeptidase S
3.4.13.20 beta-Ala-His dipeptidase
3.4.14.5 dipeptidyl-peptidase IV
3.4.21.26 prolyl oligopeptidase
3.4.22.40 bleomycin hydrolase










Phe-Gly + H2O <=> L-phenylalanine + glycine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase







Benzyloxycarbonyl-Gly-Phe + H2O <=> Benzyloxycarbonyl-Gly + L-phenylalanine 3.4.16.5 carboxypeptidase C
3.4.17.1 carboxypeptidase A
3.4.17.15 carboxypeptidase A2
3.4.17.19 carboxypeptidase Taq
3.4.17.4 Gly-Xaa carboxypeptidase
3.4.22.33 fruit bromelain
3.4.23.26 rhodotorulapepsin
3.4.24.77 snapalysin








L-phenylalanine_ethyl_ester + H2O <=> L-phenylalanine + ethanol 3.1.1.1 carboxylesterase
3.1.1.43 alpha-amino-acid esterase
3.4.22.32 stem bromelain



L-phenylalanine + 6-Methyl-5,6,7,8-tetrahydropterin + O2 <=> L-tyrosine + 6-methyldihydropterin + H2O 1.14.16.1 phenylalanine 4-monooxygenase
1.14.16.2 tyrosine 3-monooxygenase
1.14.16.4 tryptophan 5-monooxygenase



L-Dopa + phenylpyruvate <=> 3,4-Dihydroxyphenylpyruvate + L-phenylalanine 2.6.1.49 dihydroxyphenylalanine transaminase

L-phenylalanine + glyoxylate <=> phenylpyruvate + glycine 2.6.1.15 glutamine---pyruvate transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.60 aromatic-amino-acid---glyoxylate transaminase
2.6.1.63 kynurenine---glyoxylate transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.7 kynurenine---oxoglutarate transaminase








Tyr-Phe + H2O <=> L-tyrosine + L-phenylalanine 3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.13.19 membrane dipeptidase
3.4.19.1 acylaminoacyl-peptidase





Phe-Tyr + H2O <=> L-phenylalanine + L-tyrosine 3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.22 aminopeptidase I
3.4.13.19 membrane dipeptidase



Phe-7-amido-4-methylcoumarin <=> L-phenylalanine + 7-amino-4-methylcoumarin 3.3.2.6 leukotriene-A4 hydrolase
3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.11.6 aminopeptidase B
3.4.11.7 glutamyl aminopeptidase
3.4.11.B7
3.4.21.117 stratum corneum chymotryptic enzyme









benzyloxycarbonyl-Gly-Gly-Phe + H2O <=> benzyloxycarbonyl-Gly-Gly + L-phenylalanine 3.4.16.5 carboxypeptidase C
3.4.17.1 carboxypeptidase A
3.4.17.15 carboxypeptidase A2



Phe-Gly-Gly + H2O <=> L-phenylalanine + Gly-Gly 3.4.11.13 clostridial aminopeptidase
3.4.11.4 tripeptide aminopeptidase


Pro-Phe + H2O <=> L-proline + L-phenylalanine 3.4.11.13 clostridial aminopeptidase
3.4.11.5 prolyl aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.9 Xaa-Pro dipeptidase




Phe-Pro + H2O <=> L-phenylalanine + L-proline 3.4.11.9 Xaa-Pro aminopeptidase
3.4.13.9 Xaa-Pro dipeptidase


Ala-Phe + H2O <=> L-alanine + L-phenylalanine 3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.13.19 membrane dipeptidase
3.4.13.9 Xaa-Pro dipeptidase




Gly-Phe + H2O <=> glycine + L-phenylalanine 3.4.11.1 leucyl aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase
3.4.22.40 bleomycin hydrolase




Arg-Phe + H2O <=> L-arginine + L-phenylalanine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.11.6 aminopeptidase B
3.4.13.19 membrane dipeptidase






Met-Phe + H2O <=> L-methionine + L-phenylalanine 3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.13.18 cytosol nonspecific dipeptidase




Phe-Met + H2O <=> L-phenylalanine + L-methionine 3.4.11.22 aminopeptidase I
3.4.13.18 cytosol nonspecific dipeptidase


Phe-Phe + H2O <=> L-phenylalanine + L-phenylalanine 3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.22 aminopeptidase I




3''-L-phenylalanyl-gemcitabine + H2O <=> L-phenylalanine + gemcitabine 3.1.1.1 carboxylesterase

5''-L-phenylalanyl-2-bromo-5,6-dichloro-1-(beta-D-ribofuranosyl)benzimidazole + H2O <=> L-phenylalanine + 2-bromo-5,6-dichloro-1-(beta-D-ribofuranosyl)benzimidazole 3.1.1.1 carboxylesterase
3.1.1.43 alpha-amino-acid esterase


5''-L-phenylalanyl-gemcitabine + H2O <=> L-phenylalanine + gemcitabine 3.1.1.1 carboxylesterase

Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe + H2O <=> Arg-Pro-Pro-Gly-Phe-Ser-Pro + L-phenylalanine 3.4.17.23 angiotensin-converting enzyme 2

Lys-Phe + H2O <=> L-lysine + L-phenylalanine 3.4.11.15 aminopeptidase Y
3.4.11.2 membrane alanyl aminopeptidase


L-phenylalanine <=> tropate not assigned

L-phenylalanine <=> D-Cathinone not assigned

L-phenylalanine + 2 O2 + 2 reduced_flavodoxin <=> (Z)-phenylacetaldoxime + 2 flavin + CO2 + 3 H2O 1.14.14.40 phenylalanine N-monooxygenase

L-phenylalanine <=> L-homophenylalanine not assigned

L-phenylalanine + a_2-oxo_carboxylate <=> phenylpyruvate + an_L-amino_acid 2.6.1

L-tryptophan + L-phenylalanine <=> cyclo-L-Trp-L-Phe 6.3.2

tRNAMet + L-phenylalanine + ATP <=> L-phenylalanyl-[tRNAPhe] + diphosphate + AMP 6.1.1.20 phenylalanine---tRNA ligase

lysergate + L-alanine + L-phenylalanine + L-proline + H+ + acceptor <=> ergotamine + H2O + reduced_acceptor not assigned

L-phenylalanine + O2 + reduced_[NADPH-hemoprotein_reductase] <=> N-hydroxy-L-phenylalanine + oxidized_[NADPH-hemoprotein_reductase] + H2O + H+ not assigned

L-phenylalanine + tetrahydropteridine + O2 <=> L-m-Tyr + 4a-hydroxytetrahydropteridine 1.14.16.7 phenylalanine 3-monooxygenase

L-phenylalanine + 10-formyltetrahydrofolate + O2 <=> 4a-hydroxy-N10-formyltetrahydrofolate + L-tyrosine 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + H+ <=> L-phenylalanine + H+ not assigned

L-phenylalanine + L-serine + ATP <=> cyclo(L-phenylalanyl-L-seryl) + ADP + phosphate + H+ 6.3.2

R-2-hydroxy-3-methylpentanoyl-methylvalyl-[acp] + ATP + L-phenylalanine <=> R-2-hydroxy-3-methylpentanoate-methylvaline-phenylalanyl-[acp] + AMP + diphosphate + H+ 6.3.2

S-adenosyl-L-methionine + R-2-hydroxy-3-methylpentanoate-methylvaline-phenylalanyl-[acp] + ATP + L-phenylalanine <=> R-2-hydroxy-3-methylpentanoate-methylvaline-phenylalanine-methylphenylalanyl-[acp] + AMP + diphosphate + H+ + S-adenosyl-L-homocysteine 6.3.2

D-pipecolyl-[acp] + L-2-aminooctanedioate + 9-N-methoxy-tryptophan + L-phenylalanine + ATP <=> apicidin_F-[acp] + AMP + diphosphate + H+ 6.3.2

L-phenylalanine + reduced_[NADPH-hemoprotein_reductase] + O2 <=> (E)-phenylacetaldoxime + oxidized_[NADPH-hemoprotein_reductase] + H2O + CO2 1.14.14.40 phenylalanine N-monooxygenase

indole-3-acetic_acid + L-phenylalanine + ATP <=> H+ + (indol-3-yl)acetyl-L-phenylalanine + AMP + diphosphate 6.3

L-phenylalanine + ATP + gramicidin-S_synthetase + H+ <=> D-phenylalanyl-[gramicidin-S_synthetase] + AMP + diphosphate + H+ not assigned

L-phenylalanine <=> L-phenylalanine not assigned

L-phenylalanine + O2 + tetrahydropteridine <=> L-tyrosine + 4a-hydroxytetrahydropteridine 1.14.16.1 phenylalanine 4-monooxygenase

H+ + L-phenylalanine <=> H+ + L-phenylalanine not assigned

L-phenylalanine + 6,7-dimethyltetrahydrobiopterin + O2 <=> L-tyrosine + 6,7-dimethyl-4a-hydroxy-tetrahydrobiopterin 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + tetrahydrobiopterin + O2 <=> L-tyrosine + L-threo-7,8-dihydrobiopterin + H2O 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + tetrahydrobiopterin + O2 <=> L-tyrosine + DL-m-Tyr + dihydropteridine + H2O 1.14.16.2 tyrosine 3-monooxygenase

L-phenylalanine + 6-methyl-tetrahydrobiopterin + O2 <=> L-tyrosine + 6-methyl-4a-hydroxytetrahydrobiopterin 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + 6,7-dimethyltetrahydropterin + O2 <=> L-tyrosine + 4a-hydroxytetrahydrobiopterin 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + tetrahydropteridine + O2 <=> L-tyrosine + dihydropteridine + H2O 1.14.16.2 tyrosine 3-monooxygenase
1.14.16.4 tryptophan 5-monooxygenase


L-phenylalanine + 6,7-dimethyl-5,6,7,8-tetrahydrobiopterin + O2 <=> L-tyrosine + 7,8-dimethyl-6,7-dihydrobiopterin + H2O 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + 6-Methyl-5,6,7,8-tetrahydropterin + O2 <=> L-tyrosine + 4a-hydroxy-6-methyltetrahydropterin 1.14.16.1 phenylalanine 4-monooxygenase

L-phenylalanine + O2 <=> phenylpyruvate + NH3 1.13.12.15 3,4-dihydroxyphenylalanine oxidative deaminase

phenylglycinenitrile + H2O <=> L-phenylalanine + NH3 3.5.5.5 arylacetonitrilase

N-formyl-DL-phenylalanine + H2O <=> L-phenylalanine + CO2 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

N-formyl-L-phenylalanine + H2O <=> L-phenylalanine + CO2 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

benzyloxycarbonyl-Phe + H2O <=> benzyl_alcohol + CO2 + L-phenylalanine 3.5.1.64 Nalpha-benzyloxycarbonylleucine hydrolase

5''-phospho-pyridoxyl-L-phenylalanine + H2O + O2 <=> pyridoxal_5''-phosphate + L-phenylalanine + H2O2 1.4.3.5 pyridoxal 5'-phosphate synthase

N-methyl-L-phenylalanine + O2 + H2O <=> L-phenylalanine + formaldehyde + H2O2 1.5.3.2 N-methyl-L-amino-acid oxidase

L-phenylalanine + 6-Methyl-5,6,7,8-tetrahydropterin + O2 <=> L-phenylalanine + 6-methyldihydropterin + H2O2 1.14.16.1 phenylalanine 4-monooxygenase

Asp-Phe-NH2 + H2O <=> L-aspartate + L-phenylalanine + NH3 3.4.11.7 glutamyl aminopeptidase

L-phenylalanine + tetrahydropteridine + O2 <=> L-Dopa + dihydropteridine + H2O 1.14.16.2 tyrosine 3-monooxygenase

L-phenylalanine + pyridoxal_5''-phosphate <=> phenylpyruvate + pyridoxamine_5''-phosphate 4.4.1.14 1-aminocyclopropane-1-carboxylate synthase

L-Phe-NH2 + H2O <=> L-phenylalanine + NH3 3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.17 tryptophanyl aminopeptidase
3.4.11.24 aminopeptidase S
3.5.1.57 tryptophanamidase




phenylpyruvate + 2-Aminoadipate <=> L-phenylalanine + 2-oxoglutarate 2.6.1.39 2-aminoadipate transaminase

GTP + L-phenylalanine + tRNAMet <=> GMP + diphosphate + L-phenylalanyl-tRNAPhe 6.1.1.20 phenylalanine---tRNA ligase

rac-N-(aminocarbonyl)phenylalanine + H2O <=> L-phenylalanine + CO2 + NH3 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

L-phenylalanine + 2-oxoglutarate <=> 4-hydroxyphenylpyruvate + L-glutamate 2.6.1.26 thyroid-hormone transaminase

L-kynurenine + phenylpyruvate <=> L-phenylalanine + L-glutamate + H2O 2.6.1.7 kynurenine---oxoglutarate transaminase

Glu-Phe + H2O <=> L-glutamate + L-phenylalanine 3.4.11.10 bacterial leucyl aminopeptidase

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> L-phenylalanine + VNQH + LCGSH + L-leucine + L-valine + L-glutamate + L-alanine + L-leucine + L-tyrosine + LVCG + ERG + L-phenylalanine + L-phenylalanine + YTPKA 3.4.23.21 rhizopuspepsin

L-phenylalanine + NADH + O2 <=> L-tyrosine + NAD+ + H2O 1.14.13.25 methane monooxygenase (soluble)

L-phenylalanine + pyruvate + NADH <=> N-[1-(R)-(Carboxy)ethyl]-(S)-Phe + NAD+ 1.5.1.28 opine dehydrogenase

L-phenylalanine + pyridoxal_5'-phosphate <=> pyridoxamine_5'-phosphate + a_2-oxo_carboxylate 4.1.99.2 tyrosine phenol-lyase

L-phenylalanine + NADPH + O2 <=> L-tyrosine + NADP+ + H2O 1.14.13.25 methane monooxygenase (soluble)

L-phenylalanine + H2O + NADP+ <=> phenylpyruvate + NH3 + NADPH 1.4.1.16 diaminopimelate dehydrogenase
1.4.1.2 glutamate dehydrogenase
1.4.1.20 phenylalanine dehydrogenase



Phe-NH2 + H2O <=> L-phenylalanine + NH3 3.4.22.2 papain
3.5.1.101 L-proline amide hydrolase
3.5.1.13 aryl-acylamidase
3.5.1.3 omega-amidase




N-carbamoyl-L-phenylalanine + H2O <=> L-phenylalanine + CO2 + NH3 3.5.1.6 beta-ureidopropionase
3.5.1.87 N-carbamoyl-L-amino-acid hydrolase


L-phenylalanine + 6-Methyl-5,6,7,8-tetrahydropterin + O2 <=> L-m-Tyr + 4a-hydroxy-6-methyltetrahydropterin 1.14.16.7 phenylalanine 3-monooxygenase

L-phenylalanine + 6,7-dimethyltetrahydropterin + O2 <=> 4-(hydroxymethyl)phenylalanine + 3-methyl-L-tyrosine + H2O + 6,7-dimethyldihydropterin 1.14.16.1 phenylalanine 4-monooxygenase

Phe-7-amido-4-methylcoumarin + H2O <=> L-phenylalanine + 7-amino-4-methylcoumarin 3.4.11.1 leucyl aminopeptidase

Phe-7-amido-4-methylcoumarin + H2O <=> L-phenylalanine + 7-amino-4-methylcoumarin 3.4.11.2 membrane alanyl aminopeptidase

L-phenylalanine_methyl_ester + H2O <=> L-phenylalanine + methanol 3.1.1.43 alpha-amino-acid esterase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.24 aminopeptidase S



L-phenylalanine + H2O + 2 cytochrome_c <=> phenylpyruvate + NH3 + 2 ferricytochrome_c 1.4.99.B3

2 ATP + 2 L-valine + L-phenylalanine <=> 2 ADP + 2 phosphate + L-Val-L-Val-L-Phe 6.3.2.B16

3 ATP + 3 L-valine + L-phenylalanine <=> 3 ADP + 3 phosphate + L-Val-L-Val-L-Val-L-Phe 6.3.2.B16

ATP + L-phenylalanine + L-asparagine <=> ADP + phosphate + L-phenylalanyl-L-asparagine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-glutamine <=> ADP + phosphate + L-phenylalanyl-L-glutamine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-lysine + L-phenylalanine <=> ADP + phosphate + Lys-Phe 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-histidine + L-phenylalanine <=> ADP + phosphate + His-Phe 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-proline <=> ADP + phosphate + Phe-Pro 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-arginine <=> ADP + phosphate + Phe-Arg 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-lysine <=> ADP + phosphate + Phe-Lys 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-leucine <=> ADP + phosphate + Phe-Leu 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-tryptophan + L-phenylalanine <=> ADP + phosphate + L-Trp-L-Phe 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-alanine + L-phenylalanine <=> ADP + phosphate + Ala-Phe 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-tryptophan <=> ADP + phosphate + L-Phe-L-Trp 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-alanine <=> ADP + phosphate + Phe-Ala 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + glycine <=> ADP + phosphate + Phe-Gly 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-glutamine + L-phenylalanine <=> ADP + phosphate + L-glutaminyl-L-phenylalanine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-phenylalanine <=> ADP + phosphate + Phe-Phe 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-asparagine + L-phenylalanine <=> ADP + phosphate + Asn-Phe 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-methionine <=> ADP + phosphate + Phe-Met 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-arginine + L-phenylalanine <=> ADP + phosphate + Arg-Phe 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-tyrosine + L-phenylalanine <=> ADP + phosphate + Tyr-Phe 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-serine <=> ADP + phosphate + Phe-Ser 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-histidine <=> ADP + phosphate + L-Phe-L-His 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + H2O + L-phenylalaninyl-[tyrosine-binding_protein][side_1] <=> ADP + phosphate + L-phenylalanine + [tyrosine-binding_protein][side_1] 7.4.2.13

ATP + L-phenylalanine + L-cysteine <=> ADP + phosphate + L-phenylalanyl-L-cysteine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-isoleucine <=> ADP + phosphate + L-phenylalanyl-L-isoleucine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-threonine <=> ADP + phosphate + L-phenylalanyl-L-threonine 6.3.2.49 L-alanine---L-anticapsin ligase

ATP + L-phenylalanine + L-valine <=> ADP + phosphate + L-phenylalanyl-L-valine 6.3.2.49 L-alanine---L-anticapsin ligase

Ala-Phe-Tyr-Glu + H2O <=> L-alanine + L-phenylalanine + L-tyrosine + L-glutamate 3.4.11.2 membrane alanyl aminopeptidase

Ser-Phe + H2O <=> L-serine + L-phenylalanine 3.4.13.18 cytosol nonspecific dipeptidase

ATP + L-phenylalanine + tRNAPhe-s6_G76 <=> AMP + diphosphate + L-phenylalanyl-tRNAPhe 6.1.1.20 phenylalanine---tRNA ligase

ATP + L-phenylalanine + (s-pA)tRNAPhe <=> AMP + diphosphate + L-phenylalanyl-(s-pA)tRNAPhe 6.1.1.20 phenylalanine---tRNA ligase

ATP + L-phenylalanine + (s-pC)tRNAPhe <=> AMP + diphosphate + L-phenylalanyl-(s-pC)tRNAPhe 6.1.1.20 phenylalanine---tRNA ligase

ATP + L-phenylalanine + (s-pG)tRNAPhe <=> AMP + diphosphate + L-phenylalanyl-(s-pG)tRNAPhe 6.1.1.20 phenylalanine---tRNA ligase

ATP + L-phenylalanine + (s-pU)tRNAPhe <=> AMP + diphosphate + L-phenylalanyl-(s-pU)tRNAPhe 6.1.1.20 phenylalanine---tRNA ligase

ATP + L-phenylalanine + tRNAMet <=> AMP + diphosphate + L-phenylalanyl-tRNAPyl 6.1.1.26 pyrrolysine---tRNAPyl ligase

ATP + L-phenylalanine + tRNAMet <=> AMP + diphosphate + bis-L-phenylalanyl-tRNAPhe 6.1.1.20 phenylalanine---tRNA ligase

Asp-Phe + H2O <=> L-aspartate + L-phenylalanine 3.4.11.1 leucyl aminopeptidase
3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.23 PepB aminopeptidase
3.4.13.19 membrane dipeptidase
3.4.13.21 dipeptidase E





beta-Asp-Phe + H2O <=> L-aspartate + L-phenylalanine 3.4.19.5 beta-aspartyl-peptidase

L-phenylalanyl_4-nitroanilide + H2O <=> L-phenylalanine + 4-nitroaniline 3.4.11.B3
3.4.11.B9


Phe-p-nitroanilide + H2O <=> L-phenylalanine + 4-nitroaniline 3.4.19.1 acylaminoacyl-peptidase
3.4.22.40 bleomycin hydrolase


Phe-Ala + H2O <=> L-phenylalanine + L-alanine 3.4.11.22 aminopeptidase I
3.4.13.19 membrane dipeptidase
3.4.13.20 beta-Ala-His dipeptidase
3.4.17.6 alanine carboxypeptidase




L-kynurenine + phenylpyruvate <=> Kynurenic_acid + L-phenylalanine + H2O 2.6.1.7 kynurenine---oxoglutarate transaminase

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> FVNQHLCGSHL + VEA + L-leucine + L-tyrosine + LVCGERGF + L-phenylalanine + YTPKA 3.4.23.2 pepsin B

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + 6 H2O <=> FVNQHL + CGSHL + VEAL + L-tyrosine + LVCGERGF + L-phenylalanine + YTPKA 3.4.23.28 acrocylindropepsin

phenylpyruvate + DL-5-hydroxytryptophan <=> L-phenylalanine + 3-(5-Hydroxyindole)-2-oxopropanoate 2.6.1.28 tryptophan---phenylpyruvate transaminase

L-methionine_(R)-S-oxide + phenylpyruvate <=> 4-Methylsulfinyl-2-oxobutanoate + L-phenylalanine 2.6.1.64 glutamine---phenylpyruvate transaminase

L-methionine_sulfone + phenylpyruvate <=> 4-Methylsulfonyl-2-oxobutanoate + L-phenylalanine 2.6.1.64 glutamine---phenylpyruvate transaminase

N-benzyloxycarbonyl-Pro-Phe + H2O <=> N-benzyloxycarbonyl-Pro + L-phenylalanine 3.4.16.2 lysosomal Pro-Xaa carboxypeptidase

Val-Ala-Phe-OH + H2O <=> Val-Ala + L-phenylalanine 3.4.14.2 dipeptidyl-peptidase II

phenylalanine_[3-(hydroxymethyl)phenyl]guanidine + H2O <=> L-phenylalanine + [3-(hydroxymethyl)phenyl]guanidine 3.1.1.43 alpha-amino-acid esterase

Phe-Trp + H2O <=> L-phenylalanine + L-tryptophan 3.4.11.16 Xaa-Trp aminopeptidase