Copied!

Search

Please enter your request:
EnzymeDetector confidence threshold: Leave blank to show all results.
Does not work when no organism is selected!


Your translated search: L-leucine = 305 reactions were found.
State Icon Reaction EC-Number Conf. maximal confidence score from EnzymeDetector PW
H2O + Benzyloxycarbonyl-Leu + H+ <=> L-leucine + CO2 + benzyl_alcohol 3.5.1.64 Nalpha-benzyloxycarbonylleucine hydrolase

L-leucine <=> (3R)-beta-leucine 5.4.3.7 leucine 2,3-aminomutase

L-leucine + NAD+ + H2O <=> H+ + NH3 + NADH + 4-methyl-2-oxopentanoate 1.4.1.1 alanine dehydrogenase
1.4.1.20 phenylalanine dehydrogenase
1.4.1.23 valine dehydrogenase (NAD+)
1.4.1.8 valine dehydrogenase (NADP+)
1.4.1.9 leucine dehydrogenase





L-leucine + acetyl-CoA <=> H+ + N-acetyl-L-leucine + CoA 2.3.1.66 leucine N-acetyltransferase

L-leucine + 2-oxoglutarate <=> L-glutamate + 4-methyl-2-oxopentanoate 2.6.1.1 aspartate transaminase
2.6.1.2 alanine transaminase
2.6.1.39 2-aminoadipate transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.6 leucine transaminase
2.6.1.67 2-aminohexanoate transaminase
2.6.1.9 histidinol-phosphate transaminase








N3-fumarylcarboxyamido-L-2,3-diaminopropionic_acid + L-leucine + ATP <=> 3-{[(2E)-4-amino-4-oxobut-2-enoyl]amino}-L-alanyl-L-leucine + ADP + phosphate + H+ 6.3.2.47 dapdiamide synthase

Ala-Leu + H2O <=> L-alanine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.11.23 PepB aminopeptidase
3.4.13.12 Met-Xaa dipeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase
3.4.13.20 beta-Ala-His dipeptidase
3.4.24.54 mucrolysin









ATP + L-leucine + H2O <=> ADP + phosphate + L-leucine + H+ 7.4.2.1 ABC-type polar-amino-acid transporter
7.4.2.2 ABC-type nonpolar-amino-acid transporter


L-leucine <=> D-Leu 5.1.1.1 alanine racemase
5.1.1.10 amino-acid racemase
5.1.1.21 isoleucine 2-epimerase



L-leucine + 2-oxoglutarate + O2 <=> 4-hydroxy-L-leucine + succinate + CO2 1.14.11
1.14.11.45 L-isoleucine 4-hydroxylase


jasmonic_acid + L-leucine + ATP <=> jasmonoyl-L-leucine + AMP + diphosphate + H+ 6.3
6.3.2.52 jasmonoyl---L-amino acid synthetase
6.3.2.z



ATP + L-leucine + tRNALeu <=> AMP + diphosphate + L-leucyl-tRNALeu 6.1.1.4 leucine---tRNA ligase

N-acetyl-L-leucine + H2O <=> L-leucine + acetate 3.4.13.5 Xaa-methyl-His dipeptidase
3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase
3.5.1.15 aspartoacylase
3.5.1.16 acetylornithine deacetylase




Leu-NH2 + H2O <=> L-leucine + NH3 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.17 tryptophanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.24 aminopeptidase S
3.4.22.6 chymopapain
3.5.1.101 L-proline amide hydrolase
3.5.1.13 aryl-acylamidase
3.5.1.3 omega-amidase
3.5.1.4 amidase
3.5.1.57 tryptophanamidase












L-Leu-4-nitroanilide + H2O <=> L-leucine + 4-nitroaniline 3.3.2.6 leukotriene-A4 hydrolase
3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.13 clostridial aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.15 aminopeptidase Y
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.11.23 PepB aminopeptidase
3.4.11.24 aminopeptidase S
3.4.11.3 cystinyl aminopeptidase
3.4.11.5 prolyl aminopeptidase
3.4.11.6 aminopeptidase B
3.4.11.9 Xaa-Pro aminopeptidase
3.4.11.B3
3.4.11.B5
3.4.11.B6
3.4.11.B9
3.4.16.5 carboxypeptidase C
3.4.21.25 cucumisin
3.4.21.26 prolyl oligopeptidase
3.4.22.40 bleomycin hydrolase
3.4.23.4 chymosin
3.5.1.13 aryl-acylamidase

























Leu-Gly + H2O <=> L-leucine + glycine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.17 tryptophanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.11.23 PepB aminopeptidase
3.4.11.6 aminopeptidase B
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase
3.4.13.5 Xaa-methyl-His dipeptidase
3.4.24.54 mucrolysin













Leu-Leu + H2O <=> L-leucine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.15 aminopeptidase Y
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.11.23 PepB aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase
3.4.13.20 beta-Ala-His dipeptidase










Tyr-Leu + H2O <=> L-tyrosine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.23 PepB aminopeptidase
3.4.13.19 membrane dipeptidase
3.4.19.1 acylaminoacyl-peptidase
3.4.24.54 mucrolysin






L-leucine + O2 + H2O <=> 4-methyl-2-oxopentanoate + NH3 + H2O2 1.4.3.14 L-lysine oxidase
1.4.3.2 L-amino-acid oxidase


pyruvate + L-leucine <=> L-alanine + 4-methyl-2-oxopentanoate 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.84 arginine---pyruvate transaminase
2.6.1.9 histidinol-phosphate transaminase





L-leucine + glyoxylate <=> 4-methyl-2-oxopentanoate + glycine 2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.60 aromatic-amino-acid---glyoxylate transaminase
2.6.1.7 kynurenine---oxoglutarate transaminase




L-Leu-7-amido-4-methylcoumarin + H2O <=> L-leucine + 7-amino-4-methylcoumarin 3.3.2.6 leukotriene-A4 hydrolase
3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.15 aminopeptidase Y
3.4.11.18 methionyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.11.3 cystinyl aminopeptidase
3.4.11.4 tripeptide aminopeptidase
3.4.11.6 aminopeptidase B
3.4.11.7 glutamyl aminopeptidase
3.4.22.16 cathepsin H














L-leucine + 2-oxoisovalerate <=> 4-methyl-2-oxopentanoate + L-valine 2.6.1.42 branched-chain-amino-acid transaminase

L-methionine + 4-methyl-2-oxopentanoate <=> 4-methylsulfanyl-2-oxobutanoate + L-leucine 2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.88 methionine transaminase


Asp-Leu + H2O <=> L-aspartate + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.23 PepB aminopeptidase
3.4.13.21 dipeptidase E
3.4.19.5 beta-aspartyl-peptidase
3.5.1.18 succinyl-diaminopimelate desuccinylase





Leu-Leu-Leu + H2O <=> L-leucine + Leu-Leu 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.15 aminopeptidase Y
3.4.11.4 tripeptide aminopeptidase




Leu-Pro-Leu-Arg-PheNH2 + H2O <=> L-leucine + Pro-Leu-Arg-PheNH2 3.4.11.20 aminopeptidase Ey

His-Pro-Leu + H2O <=> His-Pro + L-leucine 3.4.14.11 Xaa-Pro dipeptidyl-peptidase
3.4.14.5 dipeptidyl-peptidase IV


beta-Asp-Leu + H2O <=> L-aspartate + L-leucine 3.4.19.5 beta-aspartyl-peptidase

Leu-Gly-Gly + H2O <=> L-leucine + Gly-Gly 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.13 clostridial aminopeptidase
3.4.11.17 tryptophanyl aminopeptidase
3.4.11.24 aminopeptidase S
3.4.11.4 tripeptide aminopeptidase






Leu-Pro + H2O <=> L-leucine + L-proline 3.4.11.9 Xaa-Pro aminopeptidase
3.4.13.9 Xaa-Pro dipeptidase


Leu-Met + H2O <=> L-leucine + L-methionine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.23 PepB aminopeptidase




angiotensin_I + H2O <=> angiotensin(1-9) + L-leucine 3.4.17.1 carboxypeptidase A
3.4.17.23 angiotensin-converting enzyme 2


benzyloxycarbonyl-Gly-Gly-Leu + H2O <=> benzyloxycarbonyl-Gly-Gly + L-leucine 3.4.17.1 carboxypeptidase A
3.4.17.15 carboxypeptidase A2


ATP + L-glutamate + L-leucine <=> ADP + phosphate + 5-L-glutamyl-L-leucine 6.3.2.2 glutamate---cysteine ligase

L-leucine <=> Isovalerate not assigned

L-leucine + 2 O2 + 2 NADPH + 2 H+ <=> (E/Z)-isovaleraldoxime + 3 H2O + 2 NADP+ + CO2 1.14.13

peptide_with_an_N-terminal_L-leucine + H2O <=> L-leucine + peptide 3.4.11.10 bacterial leucyl aminopeptidase

tRNALeu + L-leucine + ATP <=> L-leucyl-[tRNALeu] + diphosphate + AMP 6.1.1.4 leucine---tRNA ligase

L-leucine + H+ <=> L-leucine + H+ not assigned

L-leucine + L-threonine + L-2,4-diaminobutanoate + 6-methyloctanoyl-CoA + ATP <=> polymyxin_A + H+ + AMP + diphosphate + CoA not assigned

L-leucyl-arginomycin + H2O <=> L-leucine + arginomycin 3.4.13

demethylarginomycin + L-leucine + ATP <=> L-leucyl-demethylarginomycin + ADP + phosphate + H+ 6.3.2

L-leucyl-blasticidin_S + H2O <=> L-leucine + blasticidin_S 3.4.13

demethylblasticidin_S + L-leucine + ATP <=> L-leucyl-demethyl-blasticidin_S + ADP + phosphate + H+ 6.3.2

L-leucine + 2-oxoglutarate + O2 <=> 5-hydroxy-leucine + succinate + CO2 1.14.11

R-Hmp-MeVal-Phe-MePhe-Pro-alle-MeVal-[acp] + ATP + L-leucine <=> R-Hmp-MeVal-Phe-MePhe-Pro-alle-MeVal-Leu-[acp] + AMP + diphosphate + H+ 6.3.2

proto-zwittermicin_A-L-alanyl-[PKS] + L-leucine + L-methionine + O2 + NADPH <=> proto-zwittermicin_A + pyruvoyl-L-leucyl-L-methionine + NADP+ + H2O + polyketide-[acp] 2.3.1

N-acetyldemethylphosphinothricinyl-L-alanyl-[PhsB_non-ribosomal_peptide_synthase] + L-leucine + PhsC_non-ribosomal_peptide_synthase + ATP <=> N-acetyldemethylphosphinothricinyl-L-alanyl-L-leucyl-[PhsC_non-ribosomal_peptide_synthase] + AMP + diphosphate + PhsB_non-ribosomal_peptide_synthase + H+ 2.3.1

L-leucine + reduced_[NADPH-hemoprotein_reductase] + O2 <=> (E/Z)-isovaleraldoxime + oxidized_[NADPH-hemoprotein_reductase] + CO2 + H2O 1.14.14.M43

L-leucine + O2 + reduced_[NADPH-hemoprotein_reductase] <=> N-hydroxy-L-leucine + oxidized_[NADPH-hemoprotein_reductase] + H+ + H2O not assigned

indole-3-acetic_acid + L-leucine + ATP <=> H+ + (indol-3-yl)acetyl-L-leucine + diphosphate + AMP 6.3

(indol-3-yl)acetyl-L-leucine + H2O <=> indole-3-acetic_acid + L-leucine 3.5.1.M7

D-phenylalanyl-[gramicidin-S_synthetase] + L-proline + L-valine + L-ornithine + L-leucine + ATP <=> D-phenylalanyl-L-prolyl-L-valyl-L-ornithyl-L-leucyl-[NRPS-pcp] + AMP + diphosphate + H+ not assigned

L-leucine <=> L-leucine not assigned

Na+ + L-leucine <=> Na+ + L-leucine not assigned

H+ + L-leucine <=> H+ + L-leucine not assigned

GWTLNSAGYLLGPHAIDNHRSFHDKYGLA-NH2 + H2O <=> Gly-Trp-Thr + Leu-Asn-Ser + Ala-Gly + L-tyrosine + L-leucine + LGPHAIDNHRS + FHDKYG + Leu-Ala-NH2 3.4.24.29 aureolysin

Leu-Gly-Arg-Ser-Gly-Gly-Asp-Ile-Ile-Lys-Lys-Met-Gln-Thr-Leu + H2O <=> L-leucine + Gly-Arg-Ser-Gly-Gly-Asp-Ile-Ile-Lys-Lys-Met-Gln-Thr-Leu 3.4.11.1 leucyl aminopeptidase

Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu + H2O <=> Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu + L-leucine 3.4.17.B4
3.4.17.B5


Leu-Ala-Pro + H2O <=> L-leucine + Ala-Pro 3.4.11.9 Xaa-Pro aminopeptidase

L-leucine + 3-Indole-2-oxopropanoate <=> 4-methyl-2-oxopentanoate + L-tryptophan 2.6.1.28 tryptophan---phenylpyruvate transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.99 L-tryptophan---pyruvate aminotransferase



Leu-Ile + H2O <=> L-leucine + L-isoleucine 3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.23 PepB aminopeptidase


propionyl-CoA + L-leucine <=> CoA + propionyl-L-leucine 2.3.1.66 leucine N-acetyltransferase

benzyloxycarbonyl-Val-Leu + H2O <=> Nalpha-carbobenzoxy-Val + L-leucine 3.4.16.5 carboxypeptidase C

L-leucine + 4-hydroxyphenylpyruvate <=> 4-methyl-2-oxopentanoate + L-tyrosine 2.6.1.42 branched-chain-amino-acid transaminase

Leu-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu + H2O <=> L-leucine + SIINFEKL 3.4.11.1 leucyl aminopeptidase

Diprotin_B + H2O <=> Val-Pro + L-leucine 3.4.14.11 Xaa-Pro dipeptidyl-peptidase

L-leucine + a_2-oxo_carboxylate <=> 4-methylsulfanyl-2-oxobutanoate + an_aliphatic_L-amino_acid 2.6.1.88 methionine transaminase

Leu-Arg-Pro-Gly + H2O <=> L-leucine + Arg-Pro-Gly 3.4.11.1 leucyl aminopeptidase

L-leucine + 4-methyl-2-oxopentanoate <=> 4-methyl-2-oxopentanoate + L-leucine 2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.6 leucine transaminase


5-L-glutamyl-L-leucine <=> 5-oxoproline + L-leucine 4.3.2.9 gamma-glutamylcyclotransferase

Kemptide + H2O <=> L-leucine + Arg-Arg-Ala-Ser-Leu-Gly 3.4.11.15 aminopeptidase Y

hippuryl-His-Leu + H2O <=> hippuryl-L-His + L-leucine 3.4.17.3 lysine carboxypeptidase

L-Leu-7-amido-4-carbamoylmethylcoumarin + H2O <=> L-leucine + 7-amino-4-carbamoylmethylcoumarin 3.4.11.2 membrane alanyl aminopeptidase

Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu + H2O <=> Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His + L-leucine 3.4.17.B4
3.4.17.B5


8-azaadenosine_5''-triphosphate + L-leucine + tRNALeu <=> 8-azaadenosine_5''-monophosphate + diphosphate + L-leucyl-tRNALeu 6.1.1.4 leucine---tRNA ligase

3''-dATP + L-leucine + tRNALeu <=> 3''-dAMP + diphosphate + L-leucyl-tRNALeu 6.1.1.4 leucine---tRNA ligase

8-methylaminoadenosine_5''-triphosphate + L-leucine + tRNALeu <=> 8-methylaminoadenosine_5''-monophosphate + diphosphate + L-leucyl-tRNALeu 6.1.1.4 leucine---tRNA ligase

8-bromoadenosine_5''-triphosphate + L-leucine + tRNALeu <=> 8-bromoadenosine_5''-monophosphate + diphosphate + L-leucyl-tRNALeu 6.1.1.4 leucine---tRNA ligase

tubercidin_5''-triphosphate + L-leucine + tRNALeu <=> tubercidin_5''-phosphate + diphosphate + L-leucyl-tRNALeu 6.1.1.4 leucine---tRNA ligase

2''-dATP + L-leucine + tRNALeu <=> 2''-dAMP + diphosphate + L-leucyl-tRNALeu 6.1.1.4 leucine---tRNA ligase

L-Leu-D-Leu + H2O <=> L-leucine + D-Leu 3.4.13.17 non-stereospecific dipeptidase
3.4.13.19 membrane dipeptidase


N-Formyl-Met-Leu + H2O <=> N-formyl-L-methionine + L-leucine 3.4.19.1 acylaminoacyl-peptidase
3.4.19.7 N-formylmethionyl-peptidase


L-Leu-hydrazide + H2O <=> L-leucine + azide 3.4.11.1 leucyl aminopeptidase

benzyloxycarbonyl-Leu-Leu + H2O <=> Benzyloxycarbonyl-Leu + L-leucine 3.4.16.5 carboxypeptidase C

benzyloxycarbonyl-Pro-Leu + H2O <=> Benzyloxycarbonyl-Pro + L-leucine 3.4.16.5 carboxypeptidase C

benzyloxycarbonyl-Nle-Leu + H2O <=> benzyloxycarbonyl-Nle + L-leucine 3.4.16.5 carboxypeptidase C

benzyloxycarbonyl-Ser-Leu + H2O <=> N-[(benzyloxy)carbonyl]-L-serine + L-leucine 3.4.16.5 carboxypeptidase C

jasmonoyl-L-leucine + H2O <=> jasmonic_acid + L-leucine 3.5.1.127 jasmonoyl-L-amino acid hydrolase

9-(L-leucylamino)-5H-benzo[a]phenoxazin-5-iminium + H2O <=> oxidized_kresyl_violet + L-leucine 3.4.11.2 membrane alanyl aminopeptidase

furylacryloyl-Phe-Leu + H2O <=> 3-(2-furyl)acryloyl-L-Phe + L-leucine 3.4.16.5 carboxypeptidase C
3.4.17.1 carboxypeptidase A


LVVYPWTQRF + H2O <=> L-leucine + VVYPWTQRF 3.4.11.2 membrane alanyl aminopeptidase

L-His-L-Leu + H2O <=> L-histidine + L-leucine 3.4.11.1 leucyl aminopeptidase

N-carbamoyl-L-leucine + H2O <=> L-leucine + CO2 + NH3 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

L-leucine <=> Hydroxypyruvate + NH3 4.3.1.17 L-serine ammonia-lyase

L-leucine + H2O + 3-acetylpyridine-deamino-NAD+ <=> 4-methyl-2-oxopentanoate + NH3 + 3-acetylpyridine_hypoxanthine_nucleotide 1.4.1.9 leucine dehydrogenase

L-leucine + H2O + 3-acetylpyridine_adenine_dinucleotide <=> 4-methyl-2-oxopentanoate + NH3 + reduced_acetylpyridine_adenine_dinucleotide 1.4.1.9 leucine dehydrogenase

L-leucine + H2O + deamido-NAD+ <=> 4-methyl-2-oxopentanoate + NH3 + deamino-NADH 1.4.1.9 leucine dehydrogenase

L-leucine + H2O + thio-NAD+ <=> 4-methyl-2-oxopentanoate + NH3 + thio-NADH 1.4.1.9 leucine dehydrogenase

L-leucine + H2O + 3-pyridinealdehyde-NAD+ <=> 4-methyl-2-oxopentanoate + NH3 + 3-pyridinealdehyde-NAD+ 1.4.1.9 leucine dehydrogenase

L-leucine + H2O + 2 cytochrome_b <=> 4-methyl-2-oxopentanoate + NH3 + 2 reduced_cytochrome_b 1.4.99.B3

His-Leu + H2O <=> L-histidine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.17 tryptophanyl aminopeptidase
3.4.11.23 PepB aminopeptidase
3.4.24.54 mucrolysin




L-leucine <=> Isoamylamine + CO2 4.1.1.14 valine decarboxylase
4.1.1.57 methionine decarboxylase


N-Methyl-L-leucine + O2 + H2O <=> formaldehyde + L-leucine + H2O2 1.5.3.1 sarcosine oxidase

5''-phospho-pyridoxyl-L-leucine + H2O + O2 <=> pyridoxal_5''-phosphate + L-leucine + H2O2 1.4.3.5 pyridoxal 5'-phosphate synthase

4-Phenylazobenzyloxycarbonyl-Pro-Leu + H2O <=> 4-Phenylazobenzyloxycarbonyl-Pro + L-leucine 3.4.16.2 lysosomal Pro-Xaa carboxypeptidase

Acetyl-Phe-Leu + H2O <=> N-acetyl-L-phenylalanine + L-leucine 3.4.16.5 carboxypeptidase C

Benzyloxycarbonyl-Ala-Leu + H2O <=> Benzyloxycarbonyl-Ala + L-leucine 3.4.16.5 carboxypeptidase C
3.4.17.B4
3.4.17.B5
3.4.22.33 fruit bromelain




Leu-Trp-Leu + H2O <=> L-leucine + Trp-Leu 3.4.11.16 Xaa-Trp aminopeptidase

Leu-Trp-Met-Arg + H2O <=> L-leucine + Trp-Met-Arg 3.4.11.16 Xaa-Trp aminopeptidase

Ile-Leu + H2O <=> L-isoleucine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.23 PepB aminopeptidase


L-Leu-L-Pro-Gly-Gly + H2O <=> L-leucine + Pro-Gly-Gly 3.4.11.9 Xaa-Pro aminopeptidase

Leu-Pro-Pro + H2O <=> L-leucine + Pro-Pro 3.4.11.9 Xaa-Pro aminopeptidase

Leu-Pro-Pro + H2O <=> L-leucine + L-Pro-L-Pro 3.4.11.9 Xaa-Pro aminopeptidase

Nalpha-benzoyl-L-Leu + H2O <=> benzoate + L-leucine 3.4.17.B1
3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase


Nalpha-benzoyl-L-Leu + H2O <=> phenol + CO2 + L-leucine 3.5.1.64 Nalpha-benzyloxycarbonylleucine hydrolase

L-leucine + 2-oxobutyrate <=> 4-methyl-2-oxopentanoate + L-valine 2.6.1.42 branched-chain-amino-acid transaminase

L-valine + 2-oxoisovalerate <=> 2-oxoisovalerate + L-leucine 2.6.1.42 branched-chain-amino-acid transaminase

Benzyloxycarbonyl-Phe-Leu + H2O <=> benzyloxycarbonyl-Phe + L-leucine 3.4.16.5 carboxypeptidase C
3.4.16.6 carboxypeptidase D
3.4.17.1 carboxypeptidase A
3.4.17.4 Gly-Xaa carboxypeptidase
3.4.17.B1





Leu-enkephalin + H2O <=> L-tyrosine + L-leucine 3.1.1.7 acetylcholinesterase

Leu-enkephalin + H2O <=> L-leucine + Enkephalin 3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.3 cystinyl aminopeptidase



Leu-2-naphthylamide + H2O <=> L-leucine + 2-Naphthylamine 3.3.2.6 leukotriene-A4 hydrolase
3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.11.3 cystinyl aminopeptidase
3.4.11.5 prolyl aminopeptidase
3.4.11.6 aminopeptidase B
3.4.19.1 acylaminoacyl-peptidase
3.4.22.16 cathepsin H
3.5.1.13 aryl-acylamidase












Leu-2-naphthylamide + H2O <=> L-leucine + naphthylamine 3.4.11.14 cytosol alanyl aminopeptidase

Leu-Ala-Pro-Tyr-Lys-amide + H2O <=> L-leucine + Ala-Pro-Tyr-Lys-amide 3.4.11.22 aminopeptidase I

2-oxosuccinamic_acid + L-leucine <=> L-asparagine + 4-methyl-2-oxopentanoate 2.6.1.14 asparagine---oxo-acid transaminase
2.6.1.9 histidinol-phosphate transaminase


FVNQHLCGSHLVEAL + H2O <=> FVNQHLCGSHLVE + Ala-Leu + L-leucine 3.4.16.5 carboxypeptidase C

N-benzyloxycarbonyl-Ala-Ala-Leu + H2O <=> Benzyloxycarbonyl-Ala-Ala + L-leucine 3.4.17.18 carboxypeptidase T

L-Fur-Leu + H2O <=> Furoic_acid + L-leucine 3.4.17.B1

kallidin + H2O <=> L-leucine + bradykinin 3.4.11.1 leucyl aminopeptidase

L-leucine + 3-methyl-2-oxopentanoate <=> 4-methyl-2-oxopentanoate + L-isoleucine 2.6.1.42 branched-chain-amino-acid transaminase

L-Leu-D-Ala + H2O <=> L-leucine + D-alanine 3.4.13.19 membrane dipeptidase

L-Leu-D-Glu + H2O <=> L-leucine + D-glutamate 3.4.13.19 membrane dipeptidase

L-Leu-D-Ser + H2O <=> L-leucine + D-serine 3.4.13.19 membrane dipeptidase

Leu-Tyr + H2O <=> L-leucine + L-tyrosine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.23 PepB aminopeptidase
3.4.22.6 chymopapain
3.4.24.54 mucrolysin
3.5.1.13 aryl-acylamidase







L-Leu-benzyl_ester + H2O <=> L-leucine + benzyl_alcohol 3.4.11.1 leucyl aminopeptidase

L-Leu-benzyl_ester + H2O <=> L-leucine + benzoate 3.1.1.43 alpha-amino-acid esterase

L-leucyl-tRNALeu + H2O <=> L-leucine + tRNA 3.1.1.29 aminoacyl-tRNA hydrolase

benzyloxycarbonyl-Phe-Tyr-Leu + H2O <=> Benzyloxycarbonyl-Phe-Tyr + L-leucine 3.4.16.5 carboxypeptidase C
3.4.16.6 carboxypeptidase D


hippuryl-Lys-Leu + H2O <=> Hippuryl-L-Lys + L-leucine 3.4.17.3 lysine carboxypeptidase

L-pyroglutamyl-Leu + H2O <=> 5-oxoproline + L-leucine 3.4.19.3 pyroglutamyl-peptidase I

Leu-7-amino-4-trilfluoromethylcoumarin + H2O <=> L-leucine + 7-amino-4-trifluoromethylcoumarin 3.4.11.1 leucyl aminopeptidase

Thr-Leu + H2O <=> L-threonine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.23 PepB aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase



Val-Leu + H2O <=> L-valine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.23 PepB aminopeptidase


Benzyloxycarbonyl-Gly-Leu + H2O <=> Benzyloxycarbonyl-Gly + L-leucine 3.4.16.5 carboxypeptidase C
3.4.17.1 carboxypeptidase A
3.4.17.19 carboxypeptidase Taq
3.4.17.4 Gly-Xaa carboxypeptidase
3.4.22.33 fruit bromelain





benzyloxycarbonyl-Glu-Leu + H2O <=> Benzyloxycarbonyl-Glu + L-leucine 3.4.16.5 carboxypeptidase C

Leu-Leu-Tyr + H2O <=> L-leucine + Leu-Tyr 3.4.11.20 aminopeptidase Ey

succinyl-Leu-Leu-Val-Tyr-4-methylcoumarin-7-amide + H2O <=> N-Succinyl-L-Leu + L-leucine + Val-Tyr_4-methylcoumarin_7-amide 3.4.21.92 endopeptidase Clp

L-kynurenine + 4-methyl-2-oxopentanoate <=> 4-(2-aminophenyl)-2,4-dioxobutanoate + L-leucine 2.6.1.7 kynurenine---oxoglutarate transaminase

5-L-glutamyl-L-leucine + H2O <=> L-leucine + L-glutamate 3.4.19.13 glutathione gamma-glutamate hydrolase

Leu-Trp + H2O <=> L-leucine + L-tryptophan 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.16 Xaa-Trp aminopeptidase
3.4.11.17 tryptophanyl aminopeptidase
3.4.13.19 membrane dipeptidase





L-leucine-4-anisidide + H2O <=> L-leucine + 4-anisidine 3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.22 aminopeptidase I


FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> FVNQHLCGSH + LVEA + L-leucine + L-tyrosine + LVCGERGF + FYTPKA 3.4.23.18 aspergillopepsin I

FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> L-phenylalanine + VNQH + LCGSH + L-leucine + L-valine + L-glutamate + L-alanine + L-leucine + L-tyrosine + LVCG + ERG + L-phenylalanine + L-phenylalanine + YTPKA 3.4.23.21 rhizopuspepsin

L-leucine + H2O + NAD+ <=> trimethylpyruvate + NH3 + NADH 1.4.1.20 phenylalanine dehydrogenase

L-leucine + H2O + NAD+ <=> 2-oxoisovalerate + NH3 + NADH + H+ 1.4.1.2 glutamate dehydrogenase

L-leucine + H2O + NAD+ <=> 3-methyl-2-oxopentanoate + NH3 + NADH 1.4.1.20 phenylalanine dehydrogenase

L-leucine + pyruvate + NADH <=> N-[1-(R)-(Carboxy)ethyl]-(S)-Leu + NAD+ 1.5.1.28 opine dehydrogenase

L-leucine + oxaloacetate <=> 4-methyl-2-oxopentanoate + L-asparagine 2.6.1.42 branched-chain-amino-acid transaminase

N-acetyl-L-leucine + H2O <=> methanol + CO2 + L-leucine 3.5.1.64 Nalpha-benzyloxycarbonylleucine hydrolase

Lys-Leu + H2O <=> L-lysine + L-leucine 3.4.11.15 aminopeptidase Y

angiotensin_I + H2O <=> DRVYIHPFH + L-leucine 3.4.17.23 angiotensin-converting enzyme 2

angiotensin_I + H2O <=> des-Leu10_angiotensin_I + L-leucine 3.4.17.1 carboxypeptidase A

L-norvaline + 4-methyl-2-oxopentanoate <=> 2-Oxopentanoate + L-leucine 2.6.1.42 branched-chain-amino-acid transaminase

Z-YL-H + H2O <=> Benzyloxycarbonyl-Tyr + L-leucine 3.4.16.6 carboxypeptidase D

PMVELAGE + H2O <=> PMVE + L-leucine + AGE 3.4.23.24 candidapepsin

PMVELQGE + H2O <=> PMVE + L-leucine + QGE 3.4.23.24 candidapepsin

PMVELTGE + H2O <=> PMVE + L-leucine + Tyr-Gly-Glu 3.4.23.24 candidapepsin

PMVELWGE + H2O <=> PMVE + L-leucine + WGE 3.4.23.24 candidapepsin

L-2-aminobutanoate + 4-methyl-2-oxopentanoate <=> 2-oxobutyrate + L-leucine 2.6.1.42 branched-chain-amino-acid transaminase

L-allo-isoleucine + 4-methyl-2-oxopentanoate <=> 3-methyl-2-oxopentanoate + L-leucine 2.6.1.42 branched-chain-amino-acid transaminase

L-leucine + 2-oxobutyrate <=> 4-methyl-2-oxopentanoate + 2-aminobutanoate 2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.7 kynurenine---oxoglutarate transaminase