Copied!

Search

Please enter your request:
EnzymeDetector confidence threshold: Leave blank to show all results.
Does not work when no organism is selected!


Your translated search: L-alanine = 485 reactions were found.
State Icon Reaction EC-Number Conf. maximal confidence score from EnzymeDetector PW
L-alanine + UDP-N-acetylmuramate + ATP <=> H+ + UDP-N-acetylmuramoyl-L-Ala + phosphate + ADP 6.3.2.8 UDP-N-acetylmuramate---L-alanine ligase
6.3.2.B2


2,2'-iminodipropanoate + H2O + NAD+ <=> pyruvate + L-alanine + NADH + H+ 1.5.1.17 alanopine dehydrogenase

L-aspartate + H+ <=> L-alanine + CO2 4.1.1.12 aspartate 4-decarboxylase
4.4.1.1 cystathionine gamma-lyase


L-kynurenine + H2O <=> H+ + L-alanine + anthranilate 3.7.1.3 kynureninase

2,2-dialkylglycine + H+ + pyruvate <=> R-CO-R' + L-alanine + CO2 4.1.1.64 2,2-dialkylglycine decarboxylase (pyruvate)

NAD+ + H2O + L-alanine <=> H+ + NH3 + NADH + pyruvate 1.4.1.1 alanine dehydrogenase
1.4.1.23 valine dehydrogenase (NAD+)
1.4.1.3 glutamate dehydrogenase [NAD(P)+]
1.4.1.8 valine dehydrogenase (NADP+)
1.4.1.9 leucine dehydrogenase





pimeloyl-[acyl-carrier_protein] + L-alanine + H+ <=> 8-Amino-7-oxononanoate + CO2 + [acyl-carrier_protein] 2.3.1.47 8-amino-7-oxononanoate synthase

L-alanine + a_2-oxo_carboxylate <=> pyruvate + an_L-amino_acid 2.6.1.12 alanine---oxo-acid transaminase

malonate_semialdehyde + L-alanine <=> beta-Alanine + pyruvate 2.6.1.113 putrescine---pyruvate transaminase
2.6.1.18 beta-alanine---pyruvate transaminase
2.6.1.2 alanine transaminase
2.6.1.40 (R)-3-amino-2-methylpropionate---pyruvate transaminase
2.6.1.77 taurine---pyruvate aminotransferase





pyruvate + D-methionine <=> L-alanine + 4-methylsulfanyl-2-oxobutanoate 2.6.1.21 D-amino-acid transaminase
2.6.1.41 D-methionine---pyruvate transaminase


pyruvate + 2-aminoethylphosphonate <=> L-alanine + phosphonoacetaldehyde 2.6.1.18 beta-alanine---pyruvate transaminase
2.6.1.37 2-aminoethylphosphonate---pyruvate transaminase


2-oxoglutarate + L-alanine <=> L-glutamate + pyruvate 2.6.1.1 aspartate transaminase
2.6.1.12 alanine---oxo-acid transaminase
2.6.1.2 alanine transaminase
2.6.1.37 2-aminoethylphosphonate---pyruvate transaminase
2.6.1.39 2-aminoadipate transaminase
2.6.1.4 glycine transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.5 tyrosine transaminase
2.6.1.79 glutamate---prephenate aminotransferase









L-phenylalanine + pyruvate <=> phenylpyruvate + L-alanine 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.15 glutamine---pyruvate transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.58 phenylalanine(histidine) transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase







L-glutamine + pyruvate <=> 2-Oxoglutaramate + L-alanine 2.6.1.15 glutamine---pyruvate transaminase
2.6.1.51 serine---pyruvate transaminase


pyruvate + 5-aminolevulinate <=> L-alanine + 4,5-Dioxopentanoate 2.6.1.40 (R)-3-amino-2-methylpropionate---pyruvate transaminase
2.6.1.43 aminolevulinate transaminase


glyoxylate + L-alanine <=> glycine + pyruvate 2.6.1.15 glutamine---pyruvate transaminase
2.6.1.18 beta-alanine---pyruvate transaminase
2.6.1.2 alanine transaminase
2.6.1.4 glycine transaminase
2.6.1.40 (R)-3-amino-2-methylpropionate---pyruvate transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.45 serine---glyoxylate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.7 kynurenine---oxoglutarate transaminase
2.6.1.B16










L-2,4-diaminobutanoate + pyruvate <=> L-aspartate_4-semialdehyde + L-alanine 2.6.1.46 diaminobutyrate---pyruvate transaminase

pyruvate + L-serine <=> L-alanine + Hydroxypyruvate 2.6.1.44 alanine---glyoxylate transaminase
2.6.1.45 serine---glyoxylate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.B16





pyruvate + 1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol <=> L-alanine + 1D-1-guanidino-1-deoxy-3-dehydro-scyllo-inositol 2.6.1.56 1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase

pyruvate + L-valine <=> L-alanine + 2-oxoisovalerate 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.66 valine---pyruvate transaminase




pyruvate + L-lysine <=> L-alanine + (S)-2-amino-6-oxohexanoate 2.6.1.36 L-lysine 6-transaminase
2.6.1.71 lysine---pyruvate 6-transaminase


pyruvate + taurine <=> L-alanine + 2-sulfoacetaldehyde 2.6.1.18 beta-alanine---pyruvate transaminase
2.6.1.77 taurine---pyruvate aminotransferase


L-selenocysteine + reduced_acceptor <=> L-alanine + selenium + acceptor + H+ 4.4.1.16 selenocysteine lyase

ATP + L-alanine + anticapsin <=> ADP + phosphate + L-alanyl-L-anticapsin + H+ 6.3.2.49 L-alanine---L-anticapsin ligase

L-arginine + pyruvate <=> 5-guanidino-2-oxopentanoate + L-alanine 2.6.1.40 (R)-3-amino-2-methylpropionate---pyruvate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.84 arginine---pyruvate transaminase



4-aminobutanoate + pyruvate <=> succinate_semialdehyde + L-alanine 2.6.1.116
2.6.1.18 beta-alanine---pyruvate transaminase
2.6.1.19 4-aminobutyrate---2-oxoglutarate transaminase
2.6.1.40 (R)-3-amino-2-methylpropionate---pyruvate transaminase
2.6.1.96 4-aminobutyrate---pyruvate transaminase





L-tryptophan + pyruvate <=> L-alanine + 3-Indole-2-oxopropanoate 2.6.1.28 tryptophan---phenylpyruvate transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.5 tyrosine transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.57 aromatic-amino-acid transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.99 L-tryptophan---pyruvate aminotransferase







4-(hydroxymethyl)-2-furancarboxaldehyde_phosphate + L-alanine <=> 5-(aminomethyl)-3-furanmethanol_phosphate + pyruvate 2.6.1.108 (5-formylfuran-3-yl)methyl phosphate transaminase

putrescine + pyruvate <=> 4-Aminobutyraldehyde + L-alanine 2.6.1.113 putrescine---pyruvate transaminase
2.6.1.29 diamine transaminase
2.6.1.82 putrescine---2-oxoglutarate transaminase



(2E,5S,6E,8E,10E)-1-aminododeca-2,6,8,10-tetraen-5-ol + pyruvate <=> (2E,5S,6E,8E,10E)-5-hydroxydodeca-2,6,8,10-tetraenal + L-alanine 2.6.1.115 5-hydroxydodecatetraenal 1-aminotransferase

Ala-Gly + H2O <=> L-alanine + glycine 3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase







Ala-Leu + H2O <=> L-alanine + L-leucine 3.4.11.1 leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.22 aminopeptidase I
3.4.11.23 PepB aminopeptidase
3.4.13.12 Met-Xaa dipeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase
3.4.13.20 beta-Ala-His dipeptidase
3.4.24.54 mucrolysin









L-3-hydroxykynurenine + H2O <=> H+ + 3-Hydroxyanthranilate + L-alanine 3.7.1.3 kynureninase

H+ + pimeloyl-CoA + L-alanine <=> CO2 + CoA + 8-Amino-7-oxononanoate 2.3.1.47 8-amino-7-oxononanoate synthase

L-histidine + pyruvate <=> 3-(1H-imidazol-4-yl)-2-oxopropanoate + L-alanine 2.6.1.38 histidine transaminase
2.6.1.39 2-aminoadipate transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.58 phenylalanine(histidine) transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase






L-tyrosine + pyruvate <=> 4-hydroxyphenylpyruvate + L-alanine 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.5 tyrosine transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.58 phenylalanine(histidine) transaminase





L-cysteine_sulfinic_acid + H2O <=> H+ + L-alanine + sulfite 2.8.1.7 cysteine desulfurase
3.13.1


Ala-Glu + H2O <=> L-alanine + L-glutamate 3.4.11.14 cytosol alanyl aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase



L-Ala-L-Asp + H2O <=> L-alanine + L-aspartate 3.4.11.14 cytosol alanyl aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase



Ala-His + H2O <=> L-alanine + L-histidine 3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase
3.4.13.20 beta-Ala-His dipeptidase
3.4.13.5 Xaa-methyl-His dipeptidase




Met-Ala + H2O <=> L-methionine + L-alanine 3.4.11.18 methionyl aminopeptidase
3.4.13.12 Met-Xaa dipeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.17.6 alanine carboxypeptidase
3.4.22.40 bleomycin hydrolase





L-Ala-L-Gln + H2O <=> L-alanine + L-glutamine 3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase


L-alanine <=> D-alanine 2.6.1.21 D-amino-acid transaminase
5.1.1.1 alanine racemase
5.1.1.10 amino-acid racemase
5.1.1.12 ornithine racemase
5.1.1.13 aspartate racemase
5.1.1.15 2-aminohexano-6-lactam racemase
5.1.1.18 serine racemase
5.1.1.8 4-hydroxyproline epimerase
5.1.1.9 arginine racemase









2-Oxomalonate + L-alanine <=> aminomalonate + pyruvate 2.6.1.45 serine---glyoxylate transaminase
2.6.1.47 alanine---oxomalonate transaminase


pyruvate + pyridoxamine <=> L-alanine + pyridoxal 2.6.1.30 pyridoxamine---pyruvate transaminase

(R)-3-Amino-2-methylpropanoate + pyruvate <=> 2-Methyl-3-oxopropanoate + L-alanine 2.6.1.40 (R)-3-amino-2-methylpropionate---pyruvate transaminase

L-cysteine + [enzyme]-cysteine <=> L-alanine + [enzyme]-S-sulfanylcysteine 2.8.1.7 cysteine desulfurase

ATP + L-alanine + tRNAMet <=> AMP + diphosphate + L-alanyl-tRNA 6.1.1.15 proline---tRNA ligase
6.1.1.20 phenylalanine---tRNA ligase
6.1.1.6 lysine---tRNA ligase
6.1.1.7 alanine---tRNA ligase




L-cysteine_sulfinic_acid <=> L-alanine + SO2 4.1.1.12 aspartate 4-decarboxylase
4.4.1.1 cystathionine gamma-lyase


N-formyl-L-kynurenine + H2O <=> N-formylanthranilic_acid + L-alanine 3.7.1.3 kynureninase

pyruvate + L-2-aminobutanoate <=> L-alanine + 2-oxobutyrate 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.40 (R)-3-amino-2-methylpropionate---pyruvate transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.44 alanine---glyoxylate transaminase




pyruvate + L-aspartate <=> L-alanine + oxaloacetate 2.6.1.1 aspartate transaminase
2.6.1.12 alanine---oxo-acid transaminase
2.6.1.64 glutamine---phenylpyruvate transaminase
2.6.1.78 aspartate---prephenate aminotransferase




L-2-methyl-3-oxopropionate + L-alanine <=> (S)-3-amino-2-methylpropanoate + pyruvate 2.6.1
2.6.1.18 beta-alanine---pyruvate transaminase


anthranilate + L-tryptophan + L-alanine + ATP <=> Fumiquinazoline_F + diphosphate + AMP + H2O + H+ 6.3.2

fumiquinazoline_F-indoline-2,3''-diol + L-alanine + ATP <=> Fumiquinazoline_A + AMP + diphosphate + H2O + H+ 6.3.2

molybdenum_cofactor + L-cysteine + reduced_acceptor <=> MoOS(OH)Dtpp-mP + L-alanine + H2O + acceptor 2.8.1.9 molybdenum cofactor sulfurtransferase

cadaverine + pyruvate <=> H+ + 17-Oxosparteine + L-alanine + H2O not assigned

L-cysteine + acceptor <=> L-alanine + sulfhydryl_reagents 2.8.1.7 cysteine desulfurase
4.4.1.16 selenocysteine lyase


N-acetyl-L-alanine + H2O <=> L-alanine + acetate 3.5.1.14 N-acyl-aliphatic-L-amino acid amidohydrolase
3.5.1.15 aspartoacylase
3.5.1.16 acetylornithine deacetylase
3.5.1.32 hippurate hydrolase
3.5.1.87 N-carbamoyl-L-amino-acid hydrolase





Ala-4-nitroanilide + H2O <=> L-alanine + 4-nitroaniline 3.3.2.6 leukotriene-A4 hydrolase
3.4.11.1 leucyl aminopeptidase
3.4.11.10 bacterial leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.22 aminopeptidase I
3.4.11.24 aminopeptidase S
3.4.11.3 cystinyl aminopeptidase
3.4.11.5 prolyl aminopeptidase
3.4.11.6 aminopeptidase B
3.4.11.B3
3.4.11.B9
3.4.14.5 dipeptidyl-peptidase IV
3.4.19.1 acylaminoacyl-peptidase
3.4.21.25 cucumisin
3.4.22.40 bleomycin hydrolase

















2-aminoisobutanoate + pyruvate <=> L-alanine + acetone + CO2 4.1.1.64 2,2-dialkylglycine decarboxylase (pyruvate)

gamma-(o-aminophenyl)-L-homoserine + H2O <=> L-alanine + 2-Aminobenzaldehyde 3.7.1.3 kynureninase

4-fluoro-L-kynurenine + H2O <=> 4-fluoroanthranilate + L-alanine 3.7.1.3 kynureninase

5-fluoro-L-kynurenine + H2O <=> 5-fluoroanthranilate + L-alanine 3.7.1.3 kynureninase

L-alanine + pyridoxal_5''-phosphate <=> pyruvate + pyridoxamine_5''-phosphate 2.6.1.30 pyridoxamine---pyruvate transaminase
2.6.1.54 pyridoxamine-phosphate transaminase
3.7.1.3 kynureninase
4.4.1.14 1-aminocyclopropane-1-carboxylate synthase




L-alanine + H2O + O2 <=> pyruvate + NH3 + H2O2 1.4.3.2 L-amino-acid oxidase
1.4.3.3 D-amino-acid oxidase


pyruvate + L-leucine <=> L-alanine + 4-methyl-2-oxopentanoate 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.51 serine---pyruvate transaminase
2.6.1.84 arginine---pyruvate transaminase
2.6.1.9 histidinol-phosphate transaminase





L-alanine + 2-oxobutyrate <=> pyruvate + 2-aminobutanoate 2.6.1.12 alanine---oxo-acid transaminase
2.6.1.2 alanine transaminase
2.6.1.44 alanine---glyoxylate transaminase
2.6.1.7 kynurenine---oxoglutarate transaminase




L-kynurenine + pyruvate <=> Kynurenic_acid + L-alanine + H2O 2.6.1.7 kynurenine---oxoglutarate transaminase

L-ornithine + pyruvate <=> 1-pyrroline-5-carboxylate + L-alanine 2.6.1.13 ornithine aminotransferase

L-alanine-4-methylcoumaryl-7-amide + H2O <=> L-alanine + 7-amino-4-methylcoumarin 3.3.2.6 leukotriene-A4 hydrolase
3.4.11.1 leucyl aminopeptidase
3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.15 aminopeptidase Y
3.4.11.18 methionyl aminopeptidase
3.4.11.20 aminopeptidase Ey
3.4.11.7 glutamyl aminopeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.22.16 cathepsin H









Ala-Val + H2O <=> L-alanine + L-valine 3.4.11.14 cytosol alanyl aminopeptidase

Ala-Tyr + H2O <=> L-alanine + L-tyrosine 3.4.13.20 beta-Ala-His dipeptidase

Ala-Ala-Ala + H2O <=> L-alanine + Ala-Ala 3.4.11.13 clostridial aminopeptidase
3.4.11.4 tripeptide aminopeptidase
3.4.11.B4
3.4.11.B8
3.4.14.2 dipeptidyl-peptidase II
3.4.14.5 dipeptidyl-peptidase IV
3.4.19.1 acylaminoacyl-peptidase







L-cysteine_sulfinic_acid + reduced_acceptor <=> SO2 + L-alanine + acceptor 4.4.1.16 selenocysteine lyase

Ala-Pro + H2O <=> L-alanine + L-proline 3.4.11.5 prolyl aminopeptidase
3.4.11.9 Xaa-Pro aminopeptidase
3.4.13.5 Xaa-methyl-His dipeptidase
3.4.13.9 Xaa-Pro dipeptidase




Ala-Ala + H2O <=> L-alanine + L-alanine 3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.B4
3.4.11.B8
3.4.13.12 Met-Xaa dipeptidase
3.4.13.18 cytosol nonspecific dipeptidase
3.4.13.19 membrane dipeptidase
3.4.13.20 beta-Ala-His dipeptidase
3.4.13.9 Xaa-Pro dipeptidase
3.4.17.6 alanine carboxypeptidase
3.4.19.1 acylaminoacyl-peptidase










Ala-Phe + H2O <=> L-alanine + L-phenylalanine 3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase
3.4.13.19 membrane dipeptidase
3.4.13.9 Xaa-Pro dipeptidase




Gly-Pro-Ala + H2O <=> Gly-Pro + L-alanine 3.4.14.11 Xaa-Pro dipeptidyl-peptidase
3.4.14.2 dipeptidyl-peptidase II
3.4.14.5 dipeptidyl-peptidase IV



ATP + L-glutamate + L-alanine <=> ADP + phosphate + gamma-glutamyl-L-alanine 6.3.2.2 glutamate---cysteine ligase

beta-benzoyl-L-alanine + H2O <=> benzoate + L-alanine 3.7.1.3 kynureninase

ATP + L-alanine + L-glutamine <=> ADP + phosphate + L-Ala-L-Gln 6.3.2.49 L-alanine---L-anticapsin ligase

Tyr-Ala + H2O <=> L-tyrosine + L-alanine 3.4.17.6 alanine carboxypeptidase

pyruvate + Hypotaurine <=> L-alanine + 2-oxoethanesulfinic_acid 2.6.1.77 taurine---pyruvate aminotransferase

N-Acetylmuramoyl-Ala + H2O <=> N-acetylmuramic_acid + L-alanine 3.5.1.28 N-acetylmuramoyl-L-alanine amidase

glycolaldehyde + 2-oxobutyrate + L-alanine <=> pyridoxine not assigned

N-acetyldemethylphosphinothricin + 2 L-alanine + 3 ATP + H2O <=> N-acetyldemethyl_phosphinothricin_tripeptide + 3 AMP + 3 diphosphate not assigned

L-cysteine + protein <=> L-alanine + a_[protein]-S-sulfanyl-L-cysteine 2.8.1.7 cysteine desulfurase

pyruvate + (R)-3-Amino-2-methylpropanoate <=> L-alanine + L-2-methyl-3-oxopropionate 2.6.1.40 (R)-3-amino-2-methylpropionate---pyruvate transaminase

peptide_with_an_N-terminal_L-alanine + H2O <=> L-alanine + peptide 3.4.11.14 cytosol alanyl aminopeptidase
3.4.11.2 membrane alanyl aminopeptidase


tRNAMet + L-alanine + ATP <=> L-alanyl-[tRNAAla] + diphosphate + AMP 6.1.1.7 alanine---tRNA ligase

[peptide]_with_a_C-terminal_L-alanine + H2O <=> peptide + L-alanine 3.4.17.6 alanine carboxypeptidase

serinol_phosphate + pyruvate <=> dihydroxyacetone_phosphate + L-alanine 2.6.1.M7

lysergate + L-alanine + L-phenylalanine + L-proline + H+ + acceptor <=> ergotamine + H2O + reduced_acceptor not assigned

AP1 + pyruvate <=> (3S,5R,10R,12S,14S,15R,16R)-3,5,10,14,15-pentahydroxy-12,16-dimethylicosan-2-one + L-alanine not assigned

L-cysteine + unsulfurated_[sulfur_carrier] <=> L-alanine + sulfurated_[sulfur_carrier] 2.8.1.7 cysteine desulfurase

L-alanine + 5-oxooctanal <=> 8-aminooctan-4-one + pyruvate 2.6.1

Isobutyraldehyde + L-alanine <=> Isobutylamine + pyruvate 2.6.1

N-acetyl-alpha-D-muramoyl-L-alanine(1-) + H2O <=> N-acetylmuramic_acid + L-alanine 3.5.1.28 N-acetylmuramoyl-L-alanine amidase

L-cysteine + [cysteine_desulfurase]-S-sulfanyl-[disordered-form_scaffold_protein]_complex <=> L-alanine + S-sulfanyl-[cysteine_desulfurase]-S-sulfanyl-[disordered-form_scaffold_protein]_complex 2.8.1.7 cysteine desulfurase

L-homophenylalanine + pyruvate <=> 2-oxo-4-phenylbutanoic_acid + L-alanine 2.6.1.58 phenylalanine(histidine) transaminase

L-alanine + H+ <=> L-alanine + H+ not assigned

anthranilate + L-alanine + L-tryptophan + ATP <=> ardeemin_FQ + AMP + diphosphate + H2O + H+ 6.3.2

L-cysteine + [L-cysteine_desulfurase] <=> L-alanine + S-sulfanyl-[L-cysteine_desulfurase] 2.8.1.7 cysteine desulfurase

L-alanine + holo-[SfmA_non-ribosomal_peptide_synthase] + ATP <=> L-alanyl-[SfmA_non-ribosomal_peptide_synthase] + AMP + diphosphate 6.2.1

fatty_acid + L-alanine + glycine + holo-[SfmB_glycyl-carrier_protein] + H+ <=> acyl-L-alanyl-glycyl-[SfmB_peptidyl-carrier-protein] + H2O not assigned

fatty_acid + L-asparagine + L-serine + malonyl-CoA + aminomalonyl-[L-seryl-carrier_protein] + (2R)-2-hydroxymalonyl-[acp] + L-Albizziin + L-alanine + O2 + NADPH + H+ + polyketide-[acp] <=> proto-zwittermicin_A-L-alanyl-[PKS] + CO2 + NADP+ + H2O + holo-[L-seryl-carrier_protein] + [acyl-carrier_protein] + CoA 2.3.1

3-hydroxy-4-methyl-D-kynurenine + H2O <=> 4-methyl-3-hydroxyanthranilic_acid + L-alanine + H+ 3.7.1

quinoxaline-2-carboxyl-[aryl-carrier_protein] + L-serine + L-alanine + non-ribosomal_peptide_synthase + ATP <=> quinoxaline-2-carboxyl-D-seryl-L-alanyl-[non-ribosomal_peptide_synthase] + aryl-carrier_protein + AMP + diphosphate + H+ 6.3.2

L-alanine + ATP + H+ <=> (L-alanyl)adenylate + diphosphate not assigned

N-acetyldemethylphosphinothricinyl-L-alanyl-[PhsB_non-ribosomal_peptide_synthase] + L-alanine + PhsC_non-ribosomal_peptide_synthase + ATP <=> N-acetyldemethylphosphinothricinyl-L-alanyl-L-alanyl-[PhsC_non-ribosomal_peptide_synthase] + AMP + diphosphate + PhsB_non-ribosomal_peptide_synthase + H+ 2.3.1

3-hydroxy-4-methyl-L-kynurenine + H2O <=> 4-methyl-3-hydroxyanthranilic_acid + L-alanine + H+ 3.7.1.M2

jasmonic_acid + L-alanine + ATP <=> jasmonoyl-L-alanine + AMP + diphosphate + H+ 6.3.2.z

n-octylamine + pyruvate <=> octanal + L-alanine 2.6.1.115 5-hydroxydodecatetraenal 1-aminotransferase

L-alanyl-(2S,3E)-amino-4-methoxy-but-3-enoyl-L-alanine + H2O <=> (2S,3E)-2-amino-4-methoxy-but-3-enoate + L-alanine not assigned

L-alanine + AmbB_non-ribosomal_peptide_synthase + ATP <=> L-alanyl-[AmbB_non-ribosomal_peptide_synthase] + AMP + diphosphate 6.2.1.ag

L-alanine + holo-[L-alanyl-carrier_protein] + ATP <=> L-alanyl-[L-alanyl-carrier_protein] + AMP + diphosphate 6.2.1.ag

L-alanine + PhsB_non-ribosomal_peptide_synthase + ATP <=> L-alanyl-[PhsB_non-ribosomal_peptide_synthase] + AMP + diphosphate 6.2.1.ag

L-cysteine + adenylyl-[ThiS] + reduced_acceptor <=> thiocarboxy-[ThiS-Protein] + L-alanine + AMP + acceptor + H+ 2.8.1.7 cysteine desulfurase

L-glutamate + L-alanine + ATP <=> gamma-L-glutamyl-D-alanine + ADP + phosphate + H+ 6.3.2.2 glutamate---cysteine ligase

L-alanyl-[tRNAPro] + H2O <=> tRNAMet + L-alanine + H+ 4.2.99

indole-3-acetic_acid + L-alanine + ATP <=> H+ + (indol-3-yl)acetyl-L-alanine + AMP + diphosphate 6.3

(indol-3-yl)acetyl-L-alanine + H2O <=> indole-3-acetic_acid + L-alanine 3.5.1.M7

2-amino-4-carboxypyrimidine + L-alanine <=> lathyrine + CO2 + H2O not assigned

L-alanine + Vanillin <=> pyruvate + vanillylamine 2.6.1.aj

(S)-2-aminopropanal + H2O + NADP+ <=> L-alanine + NADPH + H+ not assigned

(S)-2-aminopropanal + H2O + NAD+ <=> L-alanine + NADH + H+ not assigned

beta-methylenecyclopropyl_pyruvate + L-alanine <=> hypoglycin + pyruvate 2.6.1

L-cysteine + [ThiI_sulfur-carrier_protein]-L-cysteine <=> L-alanine + [ThiI_sulfur-carrier_protein]-S-sulfanyl-L-cysteine 2.8.1.7 cysteine desulfurase

L-cysteine + [L-cysteine_desulfurase]-L-cysteine <=> L-alanine + [L-cysteine_desulfurase]-S-sulfanyl-L-cysteine not assigned

H+ + L-alanine <=> H+ + L-alanine not assigned

Ala-Thr + H2O <=> L-alanine + L-threonine 3.4.13.18 cytosol nonspecific dipeptidase

Na+ + L-alanine <=> Na+ + L-alanine not assigned

L-alanine + H+ <=> L-alanine + H+ not assigned

L-alanine + H2O + O2 <=> 2-Oxohexanoate + NH3 + H2O2 1.4.3.2 L-amino-acid oxidase

L-alanine + O2 <=> pyruvate + NH3 1.13.12.15 3,4-dihydroxyphenylalanine oxidative deaminase

Ala-NH2 + H2O <=> L-alanine + NH3 3.4.11.17 tryptophanyl aminopeptidase
3.5.1.101 L-proline amide hydrolase
3.5.1.13 aryl-acylamidase
3.5.1.4 amidase
3.5.1.57 tryptophanamidase





L-alanine + O2 <=> acetamide + CO2 + H2O 1.13.12.3 tryptophan 2-monooxygenase

N-formyl-DL-alanine + H2O <=> L-alanine + CO2 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

N-formyl-L-alanine + H2O <=> L-alanine + CO2 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

5''-phospho-pyridoxyl-3-alanine + H2O + O2 <=> pyridoxal_5''-phosphate + L-alanine + H2O2 1.4.3.5 pyridoxal 5'-phosphate synthase

5''-phospho-pyridoxyl-L-alanine + H2O + O2 <=> pyridoxal_5''-phosphate + L-alanine + H2O2 1.4.3.5 pyridoxal 5'-phosphate synthase

Benzyloxycarbonyl-Ala + H2O <=> benzyl_alcohol + CO2 + L-alanine 3.5.1.58 N-benzyloxycarbonylglycine hydrolase
3.5.1.64 Nalpha-benzyloxycarbonylleucine hydrolase


acetyl-CoA + L-alanine <=> CoA + N-acetyl-L-alanine 2.3.1.53 phenylalanine N-acetyltransferase

Beta-cyanoalanine + H2O <=> L-alanine + NH3 3.5.1.38 glutamin-(asparagin-)ase

Isovaline + pyruvate <=> L-alanine + 2-butanone + CO2 4.1.1.64 2,2-dialkylglycine decarboxylase (pyruvate)

L-alanine + pyruvate <=> pyruvate + L-alanine 2.6.1.42 branched-chain-amino-acid transaminase
2.6.1.44 alanine---glyoxylate transaminase


N-Carbamoyl-DL-alanine + H2O <=> L-alanine + CO2 + NH3 3.5.1.87 N-carbamoyl-L-amino-acid hydrolase

Glu-Ala + H2O <=> L-glutamate + L-alanine 3.4.11.7 glutamyl aminopeptidase
3.4.17.6 alanine carboxypeptidase


FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O <=> L-phenylalanine + VNQH + LCGSH + L-leucine + L-valine + L-glutamate + L-alanine + L-leucine + L-tyrosine + LVCG + ERG + L-phenylalanine + L-phenylalanine + YTPKA 3.4.23.21 rhizopuspepsin

L-alanine + pyruvate + NADH <=> meso-Alanopine + NAD+ + H2O 1.5.1.22 strombine dehydrogenase
1.5.1.28 opine dehydrogenase


pyruvate + H2O + NAD+ <=> L-alanine + NH3 + NADH + H+ 1.4.1.23 valine dehydrogenase (NAD+)

L-alanine + 2-oxobutyrate + NADH + H+ <=> 2-[[(1S)-1-carboxyethyl]amino]butanoic_acid + NAD+ + H2O 1.5.1.22 strombine dehydrogenase

L-alanine + glyoxylate + NADH + H+ <=> N-(carboxymethyl)-L-Ala + NAD+ + H2O 1.5.1.22 strombine dehydrogenase

L-alanine + oxaloacetate + NADH + H+ <=> [[(1S)-1-carboxyethyl]amino]propanedioic_acid + NAD+ + H2O 1.5.1.22 strombine dehydrogenase

beta-Alanine + pyruvate <=> oxaloacetate + L-alanine 2.6.1.18 beta-alanine---pyruvate transaminase

L-alanine + pyridoxal_5'-phosphate <=> pyridoxamine_5'-phosphate + a_2-oxo_carboxylate 4.1.99.2 tyrosine phenol-lyase

N-carbamoyl-L-alanine + H2O <=> L-alanine + CO2 + NH3 3.5.1.6 beta-ureidopropionase
3.5.1.87 N-carbamoyl-L-amino-acid hydrolase


L-alanine + pyruvate + NADPH <=> meso-Alanopine + NADP+ + H2O 1.5.1.22 strombine dehydrogenase

L-alanine + H2O + NADP+ <=> pyruvate + NH3 + NADPH 1.4.1.1 alanine dehydrogenase
1.4.1.2 glutamate dehydrogenase
1.4.1.3 glutamate dehydrogenase [NAD(P)+]
1.5.1.25 thiomorpholine-carboxylate dehydrogenase




UTP + UDP-N-acetylmuramate + L-alanine <=> UDP + phosphate + UDP-N-acetylmuramoyl-L-Ala 6.3.2.8 UDP-N-acetylmuramate---L-alanine ligase

tert-butyloxycarbonyl-Ala + H2O <=> tert-butanol + CO2 + L-alanine 3.5.1.64 Nalpha-benzyloxycarbonylleucine hydrolase